Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Livin/BIRC7, Human (His)

Livin/BIRC7 is an apoptosis regulator that coordinates pro- and anti-apoptotic activities and is critical for apoptosis, cell proliferation, and cell cycle control. Its anti-apoptotic functions include inhibition of CASP3, CASP7 and CASP9, as well as E3 ubiquitin protein ligase activity. Livin/BIRC7 Protein, Human (His) is the recombinant human-derived Livin/BIRC7 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

Livin/BIRC7 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/livin-birc7-protein-human-his.html

Purity

95.0

Smiles

MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGGVSPAEAQRAWWVLEPPGARDVEAQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS

Molecular Formula

79444 (Gene_ID) Q96CA5-1 (M1-S298) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SDCCAG8 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-7011R-BF594 100 µL

SDCCAG8 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Ask
View Details
Recombinant Human TLK2/PKU-ALPHA Protein
PKSH030362 50 µg

Recombinant Human TLK2/PKU-ALPHA Protein

Ask
View Details
Human hsa-miR-6871-3p miRNA Agomir
abx882406-01 5 nmol

Human hsa-miR-6871-3p miRNA Agomir

Ask
View Details
Human hsa-miR-6871-3p miRNA Agomir
abx882406-02 10 nmol

Human hsa-miR-6871-3p miRNA Agomir

Ask
View Details
OASIS (Cyclic AMP-responsive Element-binding Protein 3-like Protein 1, cAMP-responsive Element-binding Protein 3-like Protein 1, Old Astrocyte Specifically-induced Substance, Processed Cyclic AMP-responsive Element-binding Protein 3-like Protein 1, CREB3L
MBS6401545-01 0.1 mL

OASIS (Cyclic AMP-responsive Element-binding Protein 3-like Protein 1, cAMP-responsive Element-binding Protein 3-like Protein 1, Old Astrocyte Specifically-induced Substance, Processed Cyclic AMP-responsive Element-binding Protein 3-like Protein 1, CREB3L

Ask
View Details
OASIS (Cyclic AMP-responsive Element-binding Protein 3-like Protein 1, cAMP-responsive Element-binding Protein 3-like Protein 1, Old Astrocyte Specifically-induced Substance, Processed Cyclic AMP-responsive Element-binding Protein 3-like Protein 1, CREB3L
MBS6401545-02 5x 0.1 mL

OASIS (Cyclic AMP-responsive Element-binding Protein 3-like Protein 1, cAMP-responsive Element-binding Protein 3-like Protein 1, Old Astrocyte Specifically-induced Substance, Processed Cyclic AMP-responsive Element-binding Protein 3-like Protein 1, CREB3L

Ask
View Details