Livin/BIRC7, Human (His)
Livin/BIRC7 is an apoptosis regulator that coordinates pro- and anti-apoptotic activities and is critical for apoptosis, cell proliferation, and cell cycle control. Its anti-apoptotic functions include inhibition of CASP3, CASP7 and CASP9, as well as E3 ubiquitin protein ligase activity. Livin/BIRC7 Protein, Human (His) is the recombinant human-derived Livin/BIRC7 protein, expressed by E. coli , with C-His labeled tag.
Product Specifications
Product Name Alternative
Livin/BIRC7 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/livin-birc7-protein-human-his.html
Purity
95.0
Smiles
MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGGVSPAEAQRAWWVLEPPGARDVEAQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS
Molecular Formula
79444 (Gene_ID) Q96CA5-1 (M1-S298) (Accession)
Molecular Weight
Approximately 35 kDa
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC742216-500 1x 500 µL
CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940026-100 1x 100 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940270-500 1x 500 µL
Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401081-100 1x 100 µL
CD45RO (190-2F2.5), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681081-100 1x 100 µL
CD45RO (190-2F2.5), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details