Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Siglec-15, Human (Biotinylated, HEK293, Fc-Avi)

The Siglec-15 protein plays a critical role in cellular interactions, selectively binding to sialylated glycoproteins with affinity for sialic acid residues. Binding to TYROBP and HCST suggests involvement in complex signaling pathways. Siglec-15 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived Siglec-15 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.

Product Specifications

Product Name Alternative

Siglec-15 Protein, Human (Biotinylated, HEK293, Fc-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/siglec-15-protein-human-hek-293-fc-avi.html

Purity

95.0

Smiles

FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST

Molecular Formula

284266 (Gene_ID) Q6ZMC9-1 (F20-T263) (Accession)

Molecular Weight

58-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL
BNC740096-100 1x 100 µL

Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL
BNC400009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL
BNC472848-500 1x 500 µL

Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (K8.8), CF594 conjugate, 0.1mg/mL
BNC940689-100 1x 100 µL

Cytokeratin 8 (K8.8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (LN-2), CF740 conjugate, 0.1mg/mL
BNC740056-500 1x 500 µL

CD74 (LN-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), CF405S conjugate, 0.1mg/mL
BNC041786-100 1x 100 µL

P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details