Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Legumain, Mouse (HEK293, C-His)

Legumain proteins can slowly cleave aspartyl bonds, especially under acidic conditions.Legumain Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived Legumain protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

Legumain Protein, Mouse (HEK293, C-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/legumain-protein-mouse-hek293-c-his.html

Purity

98.0

Smiles

VPVGVDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIIVMMYDDIANSEENPTPGVVINRPNGTDVYKGVLKDYTGEDVTPENFLAVLRGDAEAVKGKGSGKVLKSGPRDHVFIYFTDHGATGILVFPNDDLHVKDLNKTIRYMYEHKMYQKMVFYIEACESGSMMNHLPDDINVYATTAANPKESSYACYYDEERGTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMKHRASSPISLPPVTHLDLTPSPDVPLTILKRKLLRTNDVKESQNLIGQIQQFLDARHVIEKSVHKIVSLLAGFGETAERHLSERTMLTAHDCYQEAVTHFRTHCFNWHSVTYEHALRYLYVLANLCEAPYPIDRIEMAMDKVCLSHY

Molecular Formula

19141 (Gene_ID) O89017 (V18-Y435) (Accession)

Molecular Weight

Approximately 55-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-tert-Butyl 4-[6- (5-Chloropyridin-2-yl) -7-oxo-6,7-dihydro-5H-pyrrolo[3,4-b]pyrazin-5-yl]piperazine-1,4-dicarboxylate
sc-206211 10 mg

1-tert-Butyl 4-[6- (5-Chloropyridin-2-yl) -7-oxo-6,7-dihydro-5H-pyrrolo[3,4-b]pyrazin-5-yl]piperazine-1,4-dicarboxylate

Sign In for Pricing
View Details
Recombinant Caulobacter crescentus UPF0060 membrane protein CCNA_02055 (CCNA_02055)
MBS7037040-01 0.02 mg

Recombinant Caulobacter crescentus UPF0060 membrane protein CCNA_02055 (CCNA_02055)

Sign In for Pricing
View Details
Recombinant Caulobacter crescentus UPF0060 membrane protein CCNA_02055 (CCNA_02055)
MBS7037040-02 0.1 mg

Recombinant Caulobacter crescentus UPF0060 membrane protein CCNA_02055 (CCNA_02055)

Sign In for Pricing
View Details
Recombinant Caulobacter crescentus UPF0060 membrane protein CCNA_02055 (CCNA_02055)
MBS7037040-03 5x 0.1 mg

Recombinant Caulobacter crescentus UPF0060 membrane protein CCNA_02055 (CCNA_02055)

Sign In for Pricing
View Details
ERP27 (NM_152321) Human Tagged ORF Clone Lentiviral Particle
RC206683L1V 200 µL

ERP27 (NM_152321) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PD-1 Biosimilar Antibody
orb2670880 100 Tests

PD-1 Biosimilar Antibody

Sign In for Pricing
View Details