Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Protein MRP-126

Product Specifications

Abbreviation

Recombinant Chicken MRP-126 protein

UniProt

P28318

Expression Region

1-119aa

Organism

Gallus gallus (Chicken)

Target Sequence

MSKGCQTQGPLSELEKAIDVIIDVFHQYSRREGDKDTLTRKELKLLIEKQLANYLKHVKNQVSIDQIFKDLDNNKDQQLSFGEVMLLIIRVTVATHEHLHFCEDHQQQHQHQHQHQHNH

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.6 kDa

References & Citations

"Identification of genes differentially expressed in two types of v-myb-transformed avian myelomonocytic cells." Nakano T., Graf T. Oncogene 7:527-534 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PARP16 (NM_017851) Human Over-expression Lysate
LY402632 100 µg

PARP16 (NM_017851) Human Over-expression Lysate

Sign In for Pricing
View Details
DYRK1B (NM_004714) Human Over-expression Lysate
LY401491 100 µg

DYRK1B (NM_004714) Human Over-expression Lysate

Sign In for Pricing
View Details
E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (CDH1/3256), CF647 conjugate, 0.1mg/mL
BNC473256-100 1x 100 µL

E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (CDH1/3256), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MEF2A (NM_001130927) Human Over-expression Lysate
LY427317 100 µg

MEF2A (NM_001130927) Human Over-expression Lysate

Sign In for Pricing
View Details
Uroplakin IIIB (UPK3B) Rabbit Polyclonal Antibody
TA358158 100 µL

Uroplakin IIIB (UPK3B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CMAS (NM_018686) Human Over-expression Lysate
LC402711 20 µg

CMAS (NM_018686) Human Over-expression Lysate

Sign In for Pricing
View Details