Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Protein MRP-126

Product Specifications

Abbreviation

Recombinant Chicken MRP-126 protein

UniProt

P28318

Expression Region

1-119aa

Organism

Gallus gallus (Chicken)

Target Sequence

MSKGCQTQGPLSELEKAIDVIIDVFHQYSRREGDKDTLTRKELKLLIEKQLANYLKHVKNQVSIDQIFKDLDNNKDQQLSFGEVMLLIIRVTVATHEHLHFCEDHQQQHQHQHQHQHNH

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.6 kDa

References & Citations

"Identification of genes differentially expressed in two types of v-myb-transformed avian myelomonocytic cells." Nakano T., Graf T. Oncogene 7:527-534 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Niraparib-D5 Major, >90%
TRC-N481406-1MG 1 mg

Niraparib-D5 Major, >90%

Sign In for Pricing
View Details
Frozen Tissue Blocks, Neural tissue
CB613625 1 Block

Frozen Tissue Blocks, Neural tissue

Sign In for Pricing
View Details
Rat Collagen Type III Alpha 1 (COL3a1) ELISA Kit
RDR-COL3a1-Ra-01 96 Tests

Rat Collagen Type III Alpha 1 (COL3a1) ELISA Kit

Sign In for Pricing
View Details
Rat Collagen Type III Alpha 1 (COL3a1) ELISA Kit
RDR-COL3a1-Ra-02 48 Tests

Rat Collagen Type III Alpha 1 (COL3a1) ELISA Kit

Sign In for Pricing
View Details
(±)-Paraconic Acid
TRC-P191200-500MG 500 mg

(±)-Paraconic Acid

Sign In for Pricing
View Details
T Cell Receptor (TCR) alpha/beta Mouse Monoclonal Antibody [Clone ID: IP26]
AM26003RP-N 100 Tests

T Cell Receptor (TCR) alpha/beta Mouse Monoclonal Antibody [Clone ID: IP26]

Sign In for Pricing
View Details