Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Protein MRP-126

Product Specifications

Abbreviation

Recombinant Chicken MRP-126 protein

UniProt

P28318

Expression Region

1-119aa

Organism

Gallus gallus (Chicken)

Target Sequence

MSKGCQTQGPLSELEKAIDVIIDVFHQYSRREGDKDTLTRKELKLLIEKQLANYLKHVKNQVSIDQIFKDLDNNKDQQLSFGEVMLLIIRVTVATHEHLHFCEDHQQQHQHQHQHQHNH

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.6 kDa

References & Citations

"Identification of genes differentially expressed in two types of v-myb-transformed avian myelomonocytic cells." Nakano T., Graf T. Oncogene 7:527-534 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ON-01910 Sodium Salt
TRC-O657000-25MG 25 mg

ON-01910 Sodium Salt

Sign In for Pricing
View Details
Ubiquilin (UBQLN1) (NM_053067) Human Recombinant Protein
TP304020M 100 µg

Ubiquilin (UBQLN1) (NM_053067) Human Recombinant Protein

Sign In for Pricing
View Details
AK3L1 (AK4) (N-term) Rabbit Polyclonal Antibody
AP15104PU-N 400 µL

AK3L1 (AK4) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLC37A3 Human qPCR Primer Pair (NM_207113)
HP231631 200 Reactions

SLC37A3 Human qPCR Primer Pair (NM_207113)

Sign In for Pricing
View Details
EPCAM Mouse Monoclonal Antibody [Clone ID: VU-1D9]
AM33243RP-N 100 Tests

EPCAM Mouse Monoclonal Antibody [Clone ID: VU-1D9]

Sign In for Pricing
View Details
Rapgef3 Mouse Gene Knockout Kit (CRISPR)
KN514474 1 Kit

Rapgef3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details