Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prolactin R, Rat (HEK293, His)

Prolactin R protein is a receptor for prolactin and can initiate signaling cascades to regulate physiological processes.Interacting with SMARCA1, it may be involved in chromatin remodeling.Prolactin R Protein, Rat (HEK293, His) is the recombinant rat-derived Prolactin R protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Prolactin R Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prolactin-r-protein-rat-hek293-his.html

Purity

98.0

Smiles

QSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMPNDFTLKD

Molecular Formula

24684 (Gene_ID) P05710 (Q20-D229) (Accession)

Molecular Weight

Approximately 32-41 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tofacitinib
200811 50.0mg

Tofacitinib

Sign In for Pricing
View Details
OR52N1 Peptide
DF5195-BP 1 mg

OR52N1 Peptide

Sign In for Pricing
View Details
HA Protein (C-His, H18N11)
P525077 100 µg

HA Protein (C-His, H18N11)

Sign In for Pricing
View Details
Rabbit Polyclonal West Nile Virus MP Antibody [Allophycocyanin]
NB100-56743APC 0.1 mL

Rabbit Polyclonal West Nile Virus MP Antibody [Allophycocyanin]

Sign In for Pricing
View Details
MX1 Mouse Monoclonal Antibody [Clone ID: OTI2E7]
TA812749 100 µL

MX1 Mouse Monoclonal Antibody [Clone ID: OTI2E7]

Sign In for Pricing
View Details
Recombinant Human Ubiquitin-Conjugating Enzyme E2 D1/UBE2D1/UbcH5a (N-GST)
32-8341-50 50 µg

Recombinant Human Ubiquitin-Conjugating Enzyme E2 D1/UBE2D1/UbcH5a (N-GST)

Sign In for Pricing
View Details