Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prolactin R, Rat (HEK293, His)

Prolactin R protein is a receptor for prolactin and can initiate signaling cascades to regulate physiological processes.Interacting with SMARCA1, it may be involved in chromatin remodeling.Prolactin R Protein, Rat (HEK293, His) is the recombinant rat-derived Prolactin R protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Prolactin R Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prolactin-r-protein-rat-hek293-his.html

Purity

98.0

Smiles

QSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMPNDFTLKD

Molecular Formula

24684 (Gene_ID) P05710 (Q20-D229) (Accession)

Molecular Weight

Approximately 32-41 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB21 Rabbit Polyclonal Antibody
TA326629 100 µg

RAB21 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human TEX15 Knockout A549 cell line
GTR15412515 1 Vial

Human TEX15 Knockout A549 cell line

Sign In for Pricing
View Details
MCP rabbit pAb
ES9798-01 50 µL

MCP rabbit pAb

Sign In for Pricing
View Details
MCP rabbit pAb
ES9798-02 100 µL

MCP rabbit pAb

Sign In for Pricing
View Details
Nori® Human Collagen XIII alpha 1 ELISA Kit
GR111330 96 Well

Nori® Human Collagen XIII alpha 1 ELISA Kit

Sign In for Pricing
View Details
NCBP2 (Nuclear Cap-binding Protein Subunit 2, 20kD Nuclear Cap-binding Protein, NCBP 20kD Subunit, CBP20, NCBP-interacting Protein 1, NIP1, Cell Proliferation-inducing Gene 55 Protein, CBP20, PIG55) (AP)
MBS6132498-01 0.1 mL

NCBP2 (Nuclear Cap-binding Protein Subunit 2, 20kD Nuclear Cap-binding Protein, NCBP 20kD Subunit, CBP20, NCBP-interacting Protein 1, NIP1, Cell Proliferation-inducing Gene 55 Protein, CBP20, PIG55) (AP)

Sign In for Pricing
View Details