Prolactin R, Rat (HEK293, His)
Prolactin R protein is a receptor for prolactin and can initiate signaling cascades to regulate physiological processes.Interacting with SMARCA1, it may be involved in chromatin remodeling.Prolactin R Protein, Rat (HEK293, His) is the recombinant rat-derived Prolactin R protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
Prolactin R Protein, Rat (HEK293, His), Rat, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/prolactin-r-protein-rat-hek293-his.html
Purity
98.0
Smiles
QSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMPNDFTLKD
Molecular Formula
24684 (Gene_ID) P05710 (Q20-D229) (Accession)
Molecular Weight
Approximately 32-41 kDa due to the glycosylation
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1375404-01 0.02 mg (E-Coli)
Recombinant Synechococcus sp. UDP-N-acetylmuramate--L-alanine ligase (murC)
Sign In for Pricing
View Details MBS1375404-02 0.02 mg (Yeast)
Recombinant Synechococcus sp. UDP-N-acetylmuramate--L-alanine ligase (murC)
Sign In for Pricing
View Details MBS1375404-03 0.1 mg (E-Coli)
Recombinant Synechococcus sp. UDP-N-acetylmuramate--L-alanine ligase (murC)
Sign In for Pricing
View Details 
MBS1375404-04 0.1 mg (Yeast)
Recombinant Synechococcus sp. UDP-N-acetylmuramate--L-alanine ligase (murC)
Sign In for Pricing
View Details