Prolactin R, Rat (HEK293, His)
Prolactin R protein is a receptor for prolactin and can initiate signaling cascades to regulate physiological processes.Interacting with SMARCA1, it may be involved in chromatin remodeling.Prolactin R Protein, Rat (HEK293, His) is the recombinant rat-derived Prolactin R protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
Prolactin R Protein, Rat (HEK293, His), Rat, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/prolactin-r-protein-rat-hek293-his.html
Purity
98.0
Smiles
QSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMPNDFTLKD
Molecular Formula
24684 (Gene_ID) P05710 (Q20-D229) (Accession)
Molecular Weight
Approximately 32-41 kDa due to the glycosylation
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15318405 1 Vial
Lentiviral human FAIM shRNA (UAS) - Lentiviral human FAIM shRNA (UAS) (100)
Sign In for Pricing
View Details 
VAng-Yyj3923-500gEcoli 500 µg (E. coli)
Recombinant Mycobacterium Gilvum metK Protein (aa 1-402)
Sign In for Pricing
View Details MBS6321393-01 0.2 mL
MMP17, CT (MMP17, MT4MMP, Matrix metalloproteinase-17, Membrane-type matrix metalloproteinase 4, Membrane-type-4 matrix metalloproteinase) (PE)
Sign In for Pricing
View Details