Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prolactin R, Rat (HEK293, His)

Prolactin R protein is a receptor for prolactin and can initiate signaling cascades to regulate physiological processes.Interacting with SMARCA1, it may be involved in chromatin remodeling.Prolactin R Protein, Rat (HEK293, His) is the recombinant rat-derived Prolactin R protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Prolactin R Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prolactin-r-protein-rat-hek293-his.html

Purity

98.0

Smiles

QSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMPNDFTLKD

Molecular Formula

24684 (Gene_ID) P05710 (Q20-D229) (Accession)

Molecular Weight

Approximately 32-41 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IKB alpha Monoclonal Antibody, PE-Cy7 Conjugated
bsm-56204R-PE-Cy7 100 µL

IKB alpha Monoclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
HRCT1 Recombinant Protein (Human)
RP063453 100 µg

HRCT1 Recombinant Protein (Human)

Sign In for Pricing
View Details
Helicobacter pylori Antibody (HRP)
GWB-337EE3 0.1 mL

Helicobacter pylori Antibody (HRP)

Sign In for Pricing
View Details
TRNAC15 3'UTR GFP Stable Cell Line
TU076690 1.0 mL

TRNAC15 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Vitamin D3 Receptor, phosphorylated (Ser51)
405555-01 50 µL

Vitamin D3 Receptor, phosphorylated (Ser51)

Sign In for Pricing
View Details
Vitamin D3 Receptor, phosphorylated (Ser51)
405555-02 100 µL

Vitamin D3 Receptor, phosphorylated (Ser51)

Sign In for Pricing
View Details