Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prolactin R, Rat (HEK293, His)

Prolactin R protein is a receptor for prolactin and can initiate signaling cascades to regulate physiological processes.Interacting with SMARCA1, it may be involved in chromatin remodeling.Prolactin R Protein, Rat (HEK293, His) is the recombinant rat-derived Prolactin R protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Prolactin R Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prolactin-r-protein-rat-hek293-his.html

Purity

98.0

Smiles

QSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMPNDFTLKD

Molecular Formula

24684 (Gene_ID) P05710 (Q20-D229) (Accession)

Molecular Weight

Approximately 32-41 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPM3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
47368062 1.0 µg DNA

TPM3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Adenylate kinase 5 (AK5) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A6]
TA501650BM 100 µL

Adenylate kinase 5 (AK5) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A6]

Sign In for Pricing
View Details
Recombinant Mouse FGF-8c CF
424-FC-025/CF 25 µg

Recombinant Mouse FGF-8c CF

Sign In for Pricing
View Details
Estrogen Receptor-a (Ab-104)
315255 100 µL

Estrogen Receptor-a (Ab-104)

Sign In for Pricing
View Details
EAN57 (TEX33) CytoSection
TS406729P5 25 Slides

EAN57 (TEX33) CytoSection

Sign In for Pricing
View Details
Olr1024 (NM_001000068) Rat Tagged Lenti ORF Clone
RR215607L3 10 µg

Olr1024 (NM_001000068) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details