Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prolactin R, Rat (HEK293, His)

Prolactin R protein is a receptor for prolactin and can initiate signaling cascades to regulate physiological processes.Interacting with SMARCA1, it may be involved in chromatin remodeling.Prolactin R Protein, Rat (HEK293, His) is the recombinant rat-derived Prolactin R protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Prolactin R Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prolactin-r-protein-rat-hek293-his.html

Purity

98.0

Smiles

QSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMPNDFTLKD

Molecular Formula

24684 (Gene_ID) P05710 (Q20-D229) (Accession)

Molecular Weight

Approximately 32-41 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Bad (Ser118) Polyclonal Antibody, FITC Conjugated
bs-5216R-FITC 100 µL

Phospho-Bad (Ser118) Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Anti-STRADA Antibody (Biotin)
STJ503159 100 µg

Anti-STRADA Antibody (Biotin)

Sign In for Pricing
View Details
Human Skin Melanoma Cells [SK-MEL-2]
AFG-ELL-0505 > 1x 10^6 Cells / Vial

Human Skin Melanoma Cells [SK-MEL-2]

Sign In for Pricing
View Details
ZNF615 sgRNA CRISPR Lentivector set (Human)
K2720001 3x 1.0 µg

ZNF615 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal KIAA0355 Antibody [DyLight 405]
NBP3-06372V 0.1 mL

Rabbit Polyclonal KIAA0355 Antibody [DyLight 405]

Sign In for Pricing
View Details
Zwint (NM_147138) Rat Untagged Clone
RN202150 10 µg

Zwint (NM_147138) Rat Untagged Clone

Sign In for Pricing
View Details