Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prolactin R, Rat (HEK293, His)

Prolactin R protein is a receptor for prolactin and can initiate signaling cascades to regulate physiological processes.Interacting with SMARCA1, it may be involved in chromatin remodeling.Prolactin R Protein, Rat (HEK293, His) is the recombinant rat-derived Prolactin R protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Prolactin R Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prolactin-r-protein-rat-hek293-his.html

Purity

98.0

Smiles

QSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMPNDFTLKD

Molecular Formula

24684 (Gene_ID) P05710 (Q20-D229) (Accession)

Molecular Weight

Approximately 32-41 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBPB1 discontinued
534152-01 30ul

CBPB1 discontinued

Sign In for Pricing
View Details
CBPB1 discontinued
534152-02 100 µL

CBPB1 discontinued

Sign In for Pricing
View Details
Cdadc1 (NM_001168538) Mouse Tagged ORF Clone
MR217056 10 µg

Cdadc1 (NM_001168538) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mouse GTP-binding protein Rit1, RIT1 ELISA Kit
MBS9320910-01 48 Well

Mouse GTP-binding protein Rit1, RIT1 ELISA Kit

Sign In for Pricing
View Details
Mouse GTP-binding protein Rit1, RIT1 ELISA Kit
MBS9320910-02 96 Well

Mouse GTP-binding protein Rit1, RIT1 ELISA Kit

Sign In for Pricing
View Details
Mouse GTP-binding protein Rit1, RIT1 ELISA Kit
MBS9320910-03 5x 96 Well

Mouse GTP-binding protein Rit1, RIT1 ELISA Kit

Sign In for Pricing
View Details