Prolactin R, Rat (HEK293, His)
Prolactin R protein is a receptor for prolactin and can initiate signaling cascades to regulate physiological processes.Interacting with SMARCA1, it may be involved in chromatin remodeling.Prolactin R Protein, Rat (HEK293, His) is the recombinant rat-derived Prolactin R protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
Prolactin R Protein, Rat (HEK293, His), Rat, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/prolactin-r-protein-rat-hek293-his.html
Purity
98.0
Smiles
QSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMPNDFTLKD
Molecular Formula
24684 (Gene_ID) P05710 (Q20-D229) (Accession)
Molecular Weight
Approximately 32-41 kDa due to the glycosylation
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
K6834602 1.0 µg DNA
Enpp3 sgRNA CRISPR Lentivector (Rat) (Target 1)
Sign In for Pricing
View Details abx370623-01 5x 96 Tests
Regenerating Islet Derived Protein 3 Gamma (REG3g) Antibody Pair
Sign In for Pricing
View Details 
abx370623-02 10x 96 Tests
Regenerating Islet Derived Protein 3 Gamma (REG3g) Antibody Pair
Sign In for Pricing
View Details ![Rabbit Monoclonal ART3 Antibody (063) [DyLight 350]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
NBP2-90224UV 0.1 mL
Rabbit Monoclonal ART3 Antibody (063) [DyLight 350]
Sign In for Pricing
View Details 
MBS9363870 Inquire
Donkey Interleukin 10 Antibody (Anti-IL10) ELISA Kit
Sign In for Pricing
View Details