Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prolactin R, Rat (HEK293, His)

Prolactin R protein is a receptor for prolactin and can initiate signaling cascades to regulate physiological processes.Interacting with SMARCA1, it may be involved in chromatin remodeling.Prolactin R Protein, Rat (HEK293, His) is the recombinant rat-derived Prolactin R protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Prolactin R Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prolactin-r-protein-rat-hek293-his.html

Purity

98.0

Smiles

QSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMPNDFTLKD

Molecular Formula

24684 (Gene_ID) P05710 (Q20-D229) (Accession)

Molecular Weight

Approximately 32-41 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human OPN4 shRNA (UAS) - Lentiviral human OPN4 shRNA (UAS, iRFP) (25)
GTR15311033 1 Vial

Lentiviral human OPN4 shRNA (UAS) - Lentiviral human OPN4 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Human Monoclonal HA Tag Antibody (RMH02) [DyLight 550]
NBP3-26050R 0.1 mL

Human Monoclonal HA Tag Antibody (RMH02) [DyLight 550]

Sign In for Pricing
View Details
TAS2R40 Protein Vector (Rat) (pPB-C-His)
PV309834 500 ng

TAS2R40 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Rat Interleukin 20 ELISA Kit
MBS030192-01 48 Well

Rat Interleukin 20 ELISA Kit

Sign In for Pricing
View Details
Rat Interleukin 20 ELISA Kit
MBS030192-02 96 Well

Rat Interleukin 20 ELISA Kit

Sign In for Pricing
View Details
Rat Interleukin 20 ELISA Kit
MBS030192-03 5x 96 Well

Rat Interleukin 20 ELISA Kit

Sign In for Pricing
View Details