Prolactin R, Rat (HEK293, His)
Prolactin R protein is a receptor for prolactin and can initiate signaling cascades to regulate physiological processes.Interacting with SMARCA1, it may be involved in chromatin remodeling.Prolactin R Protein, Rat (HEK293, His) is the recombinant rat-derived Prolactin R protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
Prolactin R Protein, Rat (HEK293, His), Rat, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/prolactin-r-protein-rat-hek293-his.html
Purity
98.0
Smiles
QSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMPNDFTLKD
Molecular Formula
24684 (Gene_ID) P05710 (Q20-D229) (Accession)
Molecular Weight
Approximately 32-41 kDa due to the glycosylation
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
VAng-Ly2714-1mgEcoli 1 mg (E. coli)
Recombinant Campylobacter Jejuni leuC Protein (aa 1-468) (strain 81116 / NCTC 11828)
Sign In for Pricing
View Details 
MPC3305K Each
Magic™ Membrane Protein Human OR52B4 (Olfactory receptor family 52 subfamily B member 4) Full Length
Sign In for Pricing
View Details