Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prolactin R, Rat (HEK293, His)

Prolactin R protein is a receptor for prolactin and can initiate signaling cascades to regulate physiological processes.Interacting with SMARCA1, it may be involved in chromatin remodeling.Prolactin R Protein, Rat (HEK293, His) is the recombinant rat-derived Prolactin R protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Prolactin R Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prolactin-r-protein-rat-hek293-his.html

Purity

98.0

Smiles

QSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMPNDFTLKD

Molecular Formula

24684 (Gene_ID) P05710 (Q20-D229) (Accession)

Molecular Weight

Approximately 32-41 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

3110082I17Rik (NM_028469) Mouse Tagged Lenti ORF Clone
MR213888L4 10 µg

3110082I17Rik (NM_028469) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Flupyradifurone
TRC-F598615-25MG 25 mg

Flupyradifurone

Sign In for Pricing
View Details
Phospho-Beclin 1-Ser90 polyclonal antibody
BS79510-01 50 µL

Phospho-Beclin 1-Ser90 polyclonal antibody

Sign In for Pricing
View Details
Phospho-Beclin 1-Ser90 polyclonal antibody
BS79510-02 100 µL

Phospho-Beclin 1-Ser90 polyclonal antibody

Sign In for Pricing
View Details
ZNF710 (NM_198526) Human Tagged ORF Clone Lentiviral Particle
RC218609L1V 200 µL

ZNF710 (NM_198526) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PPIAP20 Protein Vector (Human) (pPB-C-His)
PV112558 500 ng

PPIAP20 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details