Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COQ7, Human (HEK293, His)

The COQ7 protein is a key enzyme in lipid A biosynthesis and catalyzes a key hydrolysis step involving UDP-3-O-myristoyl-N-acetylglucosamine. This activity leads to the formation of UDP-3-O-myristoylglucosamine and acetate, which is a decisive point in lipid A synthesis. COQ7 Protein, Human (HEK293, His) is the recombinant human-derived COQ7 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

COQ7 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/coq7-protein-human-hek-293-his.html

Purity

98.00

Smiles

SGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL

Molecular Formula

10229 (Gene_ID) Q99807-1 (S37-L217) (Accession)

Molecular Weight

Approximately 19-27 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Yunaconitine
AB0340 20 mg

Yunaconitine

Sign In for Pricing
View Details
Tut1 (NM_001033901) Rat Tagged ORF Clone Lentiviral Particle
RR212067L3V 200 µL

Tut1 (NM_001033901) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
C7orf36, ID (YAE1D1, C7orf36, Yae1 domain-containing protein 1) (MaxLight 550) discontinued
033046-ML550 100 µL

C7orf36, ID (YAE1D1, C7orf36, Yae1 domain-containing protein 1) (MaxLight 550) discontinued

Sign In for Pricing
View Details
NFAT5 antibody
70R-8206 50 ug

NFAT5 antibody

Sign In for Pricing
View Details
Rabbit anti-IL-27B Antibody
YLD4325-01 50 µL

Rabbit anti-IL-27B Antibody

Sign In for Pricing
View Details
Rabbit anti-IL-27B Antibody
YLD4325-02 100 µL

Rabbit anti-IL-27B Antibody

Sign In for Pricing
View Details