Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COQ7, Human (HEK293, His)

The COQ7 protein is a key enzyme in lipid A biosynthesis and catalyzes a key hydrolysis step involving UDP-3-O-myristoyl-N-acetylglucosamine. This activity leads to the formation of UDP-3-O-myristoylglucosamine and acetate, which is a decisive point in lipid A synthesis. COQ7 Protein, Human (HEK293, His) is the recombinant human-derived COQ7 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

COQ7 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/coq7-protein-human-hek-293-his.html

Purity

98.00

Smiles

SGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL

Molecular Formula

10229 (Gene_ID) Q99807-1 (S37-L217) (Accession)

Molecular Weight

Approximately 19-27 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella Flexneri fixA Protein (aa 1-256) (serotype 5b)
VAng-Lsx07743-50gEcoli 50 µg (E. coli)

Recombinant Shigella Flexneri fixA Protein (aa 1-256) (serotype 5b)

Sign In for Pricing
View Details
Rabbit anti-BAI3 Antibody
YLD0767-01 50 µL

Rabbit anti-BAI3 Antibody

Sign In for Pricing
View Details
Rabbit anti-BAI3 Antibody
YLD0767-02 100 µL

Rabbit anti-BAI3 Antibody

Sign In for Pricing
View Details
ICT1 Rabbit pAb (APR18512N)
APR18512N-01 50 µL

ICT1 Rabbit pAb (APR18512N)

Sign In for Pricing
View Details
ICT1 Rabbit pAb (APR18512N)
APR18512N-02 100 µL

ICT1 Rabbit pAb (APR18512N)

Sign In for Pricing
View Details
ICT1 Rabbit pAb (APR18512N)
APR18512N-03 200 µL

ICT1 Rabbit pAb (APR18512N)

Sign In for Pricing
View Details