Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COQ7, Human (HEK293, His)

The COQ7 protein is a key enzyme in lipid A biosynthesis and catalyzes a key hydrolysis step involving UDP-3-O-myristoyl-N-acetylglucosamine. This activity leads to the formation of UDP-3-O-myristoylglucosamine and acetate, which is a decisive point in lipid A synthesis. COQ7 Protein, Human (HEK293, His) is the recombinant human-derived COQ7 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

COQ7 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/coq7-protein-human-hek-293-his.html

Purity

98.00

Smiles

SGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL

Molecular Formula

10229 (Gene_ID) Q99807-1 (S37-L217) (Accession)

Molecular Weight

Approximately 19-27 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRAXA Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV726174 1.0 µg DNA

FRAXA Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
PLDN antibody
70R-35798 100 ug

PLDN antibody

Sign In for Pricing
View Details
OTUB2 antibody
MBS833186-01 0.1 mL

OTUB2 antibody

Sign In for Pricing
View Details
OTUB2 antibody
MBS833186-02 5x 0.1 mL

OTUB2 antibody

Sign In for Pricing
View Details
Wright's Staining Solution For Microscopy
02842 00500 500 mL

Wright's Staining Solution For Microscopy

Sign In for Pricing
View Details
PAGE4 Human shRNA Plasmid Kit (Locus ID 9506)
TR316862 1 Kit

PAGE4 Human shRNA Plasmid Kit (Locus ID 9506)

Sign In for Pricing
View Details