Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COQ7, Human (HEK293, His)

The COQ7 protein is a key enzyme in lipid A biosynthesis and catalyzes a key hydrolysis step involving UDP-3-O-myristoyl-N-acetylglucosamine. This activity leads to the formation of UDP-3-O-myristoylglucosamine and acetate, which is a decisive point in lipid A synthesis. COQ7 Protein, Human (HEK293, His) is the recombinant human-derived COQ7 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

COQ7 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/coq7-protein-human-hek-293-his.html

Purity

98.00

Smiles

SGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL

Molecular Formula

10229 (Gene_ID) Q99807-1 (S37-L217) (Accession)

Molecular Weight

Approximately 19-27 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal BAI3 Antibody (409633) [Allophycocyanin]
FAB39651A 0.1 mL

Mouse Monoclonal BAI3 Antibody (409633) [Allophycocyanin]

Sign In for Pricing
View Details
Bovine Galactocerebrosidase (GALC) ELISA Kit
MBS9348433-01 48 Well

Bovine Galactocerebrosidase (GALC) ELISA Kit

Sign In for Pricing
View Details
Bovine Galactocerebrosidase (GALC) ELISA Kit
MBS9348433-02 96 Well

Bovine Galactocerebrosidase (GALC) ELISA Kit

Sign In for Pricing
View Details
Bovine Galactocerebrosidase (GALC) ELISA Kit
MBS9348433-03 5x 96 Well

Bovine Galactocerebrosidase (GALC) ELISA Kit

Sign In for Pricing
View Details
Bovine Galactocerebrosidase (GALC) ELISA Kit
MBS9348433-04 10x 96 Well

Bovine Galactocerebrosidase (GALC) ELISA Kit

Sign In for Pricing
View Details
TMEM205 Protein Vector (Mouse) (pPM-C-His)
PV239465 500 ng

TMEM205 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details