Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COQ7, Human (HEK293, His)

The COQ7 protein is a key enzyme in lipid A biosynthesis and catalyzes a key hydrolysis step involving UDP-3-O-myristoyl-N-acetylglucosamine. This activity leads to the formation of UDP-3-O-myristoylglucosamine and acetate, which is a decisive point in lipid A synthesis. COQ7 Protein, Human (HEK293, His) is the recombinant human-derived COQ7 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

COQ7 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/coq7-protein-human-hek-293-his.html

Purity

98.00

Smiles

SGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL

Molecular Formula

10229 (Gene_ID) Q99807-1 (S37-L217) (Accession)

Molecular Weight

Approximately 19-27 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NIPAL3 Recombinant Protein (Mouse)
RP154151 100 µg

NIPAL3 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Erlenmeyer Flask, 250ml, PC, Vent Cap, Baffled Base, Individually Wrapped, 12 un. - ABDOS
P21215 12 Units/Pack

Erlenmeyer Flask, 250ml, PC, Vent Cap, Baffled Base, Individually Wrapped, 12 un. - ABDOS

Sign In for Pricing
View Details
Beta TRCP (BTRC) (NM_033637) Human Tagged Lenti ORF Clone
RC207025L1 10 µg

Beta TRCP (BTRC) (NM_033637) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Aptenodytes forsteri Hemoglobin subunit beta (HBB)
MBS1173348-01 0.02 mg (E-Coli)

Recombinant Aptenodytes forsteri Hemoglobin subunit beta (HBB)

Sign In for Pricing
View Details
Recombinant Aptenodytes forsteri Hemoglobin subunit beta (HBB)
MBS1173348-02 0.1 mg (E-Coli)

Recombinant Aptenodytes forsteri Hemoglobin subunit beta (HBB)

Sign In for Pricing
View Details
Recombinant Aptenodytes forsteri Hemoglobin subunit beta (HBB)
MBS1173348-03 0.02 mg (Yeast)

Recombinant Aptenodytes forsteri Hemoglobin subunit beta (HBB)

Sign In for Pricing
View Details