Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COQ7, Human (HEK293, His)

The COQ7 protein is a key enzyme in lipid A biosynthesis and catalyzes a key hydrolysis step involving UDP-3-O-myristoyl-N-acetylglucosamine. This activity leads to the formation of UDP-3-O-myristoylglucosamine and acetate, which is a decisive point in lipid A synthesis. COQ7 Protein, Human (HEK293, His) is the recombinant human-derived COQ7 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

COQ7 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/coq7-protein-human-hek-293-his.html

Purity

98.00

Smiles

SGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL

Molecular Formula

10229 (Gene_ID) Q99807-1 (S37-L217) (Accession)

Molecular Weight

Approximately 19-27 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

THEM2 (ACOT13, THEM2, Acyl-coenzyme A thioesterase 13, Thioesterase Superfamily member 2) (FITC)
MBS6121420-01 0.2 mL

THEM2 (ACOT13, THEM2, Acyl-coenzyme A thioesterase 13, Thioesterase Superfamily member 2) (FITC)

Ask
View Details
THEM2 (ACOT13, THEM2, Acyl-coenzyme A thioesterase 13, Thioesterase Superfamily member 2) (FITC)
MBS6121420-02 5x 0.2 mL

THEM2 (ACOT13, THEM2, Acyl-coenzyme A thioesterase 13, Thioesterase Superfamily member 2) (FITC)

Ask
View Details
RPS13, Recombinant, Human, aa3-151, GST-Tag (40S Ribosomal Protein S13)
375135-01 20 µg

RPS13, Recombinant, Human, aa3-151, GST-Tag (40S Ribosomal Protein S13)

Ask
View Details
RPS13, Recombinant, Human, aa3-151, GST-Tag (40S Ribosomal Protein S13)
375135-02 100 µg

RPS13, Recombinant, Human, aa3-151, GST-Tag (40S Ribosomal Protein S13)

Ask
View Details
RPS13, Recombinant, Human, aa3-151, GST-Tag (40S Ribosomal Protein S13)
375135-03 1 mg

RPS13, Recombinant, Human, aa3-151, GST-Tag (40S Ribosomal Protein S13)

Ask
View Details
AGFG1 Human qPCR Template Standard (NM_004504)
HK203817 1 Kit

AGFG1 Human qPCR Template Standard (NM_004504)

Ask
View Details