Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COQ7, Human (HEK293, His)

The COQ7 protein is a key enzyme in lipid A biosynthesis and catalyzes a key hydrolysis step involving UDP-3-O-myristoyl-N-acetylglucosamine. This activity leads to the formation of UDP-3-O-myristoylglucosamine and acetate, which is a decisive point in lipid A synthesis. COQ7 Protein, Human (HEK293, His) is the recombinant human-derived COQ7 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

COQ7 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/coq7-protein-human-hek-293-his.html

Purity

98.00

Smiles

SGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL

Molecular Formula

10229 (Gene_ID) Q99807-1 (S37-L217) (Accession)

Molecular Weight

Approximately 19-27 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

4933421I07RIK AAV Vector (Mouse) (CMV)
52112104 1 µg

4933421I07RIK AAV Vector (Mouse) (CMV)

Ask
View Details
TEAD4 (Transcriptional Enhancer Factor TEF-3, TEA Domain Family Member 4, TEAD-4, Transcription Factor RTEF-1, Transcription Factor 13-like 1, RTEF1, TCF13L1, TEF3, MGC9014) (FITC)
MBS6396272-01 0.1 mL

TEAD4 (Transcriptional Enhancer Factor TEF-3, TEA Domain Family Member 4, TEAD-4, Transcription Factor RTEF-1, Transcription Factor 13-like 1, RTEF1, TCF13L1, TEF3, MGC9014) (FITC)

Ask
View Details
TEAD4 (Transcriptional Enhancer Factor TEF-3, TEA Domain Family Member 4, TEAD-4, Transcription Factor RTEF-1, Transcription Factor 13-like 1, RTEF1, TCF13L1, TEF3, MGC9014) (FITC)
MBS6396272-02 5x 0.1 mL

TEAD4 (Transcriptional Enhancer Factor TEF-3, TEA Domain Family Member 4, TEAD-4, Transcription Factor RTEF-1, Transcription Factor 13-like 1, RTEF1, TCF13L1, TEF3, MGC9014) (FITC)

Ask
View Details
PE/Cyanine5.5 Rat IgG2a, κ Isotype Control
JOT22531F 25μg

PE/Cyanine5.5 Rat IgG2a, κ Isotype Control

Ask
View Details
LAG-1 Human, His
OM301751-01 20 µg

LAG-1 Human, His

Ask
View Details
LAG-1 Human, His
OM301751-02 5 µg

LAG-1 Human, His

Ask
View Details