Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AG-2, Mouse (HEK293, His)

AG-2 protein is essential for the post-transcriptional synthesis and secretion of MUC2, a key component of mucus.It plays an important role in intestinal cell mucus production and is considered a proto-oncogene with potential effects on cell migration, differentiation and growth.AG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived AG-2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AG-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ag-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Molecular Formula

23795 (Gene_ID) O88312 (K21-L175) (Accession)

Molecular Weight

Approximately 20-22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR0B2 3'UTR GFP Stable Cell Line
TU065961 1.0 mL

NR0B2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PIB5PA (INPP5J) (NM_001002837) Human Recombinant Protein
PH34296M5 20 µg

PIB5PA (INPP5J) (NM_001002837) Human Recombinant Protein

Sign In for Pricing
View Details
Biotinylated Anti-rabbit IL-4 PAb
GWB-BXIV66 1 Kit

Biotinylated Anti-rabbit IL-4 PAb

Sign In for Pricing
View Details
Recombinant Listeria welshimeri serovar 6b UDP-N-acetylmuramate--L-alanine ligase (murC)
MBS1109603-01 0.02 mg (E-Coli)

Recombinant Listeria welshimeri serovar 6b UDP-N-acetylmuramate--L-alanine ligase (murC)

Sign In for Pricing
View Details
Recombinant Listeria welshimeri serovar 6b UDP-N-acetylmuramate--L-alanine ligase (murC)
MBS1109603-02 0.02 mg (Yeast)

Recombinant Listeria welshimeri serovar 6b UDP-N-acetylmuramate--L-alanine ligase (murC)

Sign In for Pricing
View Details
Recombinant Listeria welshimeri serovar 6b UDP-N-acetylmuramate--L-alanine ligase (murC)
MBS1109603-03 0.1 mg (E-Coli)

Recombinant Listeria welshimeri serovar 6b UDP-N-acetylmuramate--L-alanine ligase (murC)

Sign In for Pricing
View Details