Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AG-2, Mouse (HEK293, His)

AG-2 protein is essential for the post-transcriptional synthesis and secretion of MUC2, a key component of mucus.It plays an important role in intestinal cell mucus production and is considered a proto-oncogene with potential effects on cell migration, differentiation and growth.AG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived AG-2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AG-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ag-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Molecular Formula

23795 (Gene_ID) O88312 (K21-L175) (Accession)

Molecular Weight

Approximately 20-22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3, epsilon (Early T Cell Marker) (Biotin)
C2254-11F 500 µg

CD3, epsilon (Early T Cell Marker) (Biotin)

Sign In for Pricing
View Details
TMPRSS2
590632 100 µg

TMPRSS2

Sign In for Pricing
View Details
Goat anti-GLUT8/SLC2A8 Antibody
MBS421135-01 0.1 mg

Goat anti-GLUT8/SLC2A8 Antibody

Sign In for Pricing
View Details
Goat anti-GLUT8/SLC2A8 Antibody
MBS421135-02 5x 0.1 mg

Goat anti-GLUT8/SLC2A8 Antibody

Sign In for Pricing
View Details
C14orf50 (PPP1R36) Human siRNA Oligo Duplex (Locus ID 145376)
SR315501 1 Kit

C14orf50 (PPP1R36) Human siRNA Oligo Duplex (Locus ID 145376)

Sign In for Pricing
View Details
G protein alpha Inhibitor 2 (GNAI2) (NM_002070) Human Over-expression Lysate
LC400760 20 µg

G protein alpha Inhibitor 2 (GNAI2) (NM_002070) Human Over-expression Lysate

Sign In for Pricing
View Details