Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AG-2, Mouse (HEK293, His)

AG-2 protein is essential for the post-transcriptional synthesis and secretion of MUC2, a key component of mucus.It plays an important role in intestinal cell mucus production and is considered a proto-oncogene with potential effects on cell migration, differentiation and growth.AG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived AG-2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AG-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ag-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Molecular Formula

23795 (Gene_ID) O88312 (K21-L175) (Accession)

Molecular Weight

Approximately 20-22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Erwinia carotovora subsp. atroseptica Arginine exporter protein ArgO (argO), partial
MBS7085498 Inquire

Recombinant Erwinia carotovora subsp. atroseptica Arginine exporter protein ArgO (argO), partial

Sign In for Pricing
View Details
Dpy30 Mouse shRNA Lentiviral Particle (Locus ID 66310)
TL519243V 500 µL Each

Dpy30 Mouse shRNA Lentiviral Particle (Locus ID 66310)

Sign In for Pricing
View Details
Gm6812 Mouse shRNA Plasmid (Locus ID 627927)
TR518341 1 Kit

Gm6812 Mouse shRNA Plasmid (Locus ID 627927)

Sign In for Pricing
View Details
NR6A1 (Nuclear Receptor Subfamily 6 Group A Member 1, Germ Cell Nuclear Factor, GCNF, hGCNF, Retinoid Receptor-related Testis-specific Receptor, RTR, hRTR, GCNF)
130561 100 µg

NR6A1 (Nuclear Receptor Subfamily 6 Group A Member 1, Germ Cell Nuclear Factor, GCNF, hGCNF, Retinoid Receptor-related Testis-specific Receptor, RTR, hRTR, GCNF)

Sign In for Pricing
View Details
Aquaporin-7 Peptide
NBP1-30862PEP 50 µg

Aquaporin-7 Peptide

Sign In for Pricing
View Details
Antimicrobial Compound 1 10mM * 1mL in DMSO
A20189-10mM-D 10 mM x 1mL in DMSO

Antimicrobial Compound 1 10mM * 1mL in DMSO

Sign In for Pricing
View Details