Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AG-2, Mouse (HEK293, His)

AG-2 protein is essential for the post-transcriptional synthesis and secretion of MUC2, a key component of mucus.It plays an important role in intestinal cell mucus production and is considered a proto-oncogene with potential effects on cell migration, differentiation and growth.AG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived AG-2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AG-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ag-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Molecular Formula

23795 (Gene_ID) O88312 (K21-L175) (Accession)

Molecular Weight

Approximately 20-22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Klf6 Rat shRNA Plasmid (Locus ID 58954)
TR711446 1 Kit

Klf6 Rat shRNA Plasmid (Locus ID 58954)

Sign In for Pricing
View Details
OR2F1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1494407 1.0 µg DNA

OR2F1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
DPRXP7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0629707 1.0 µg DNA

DPRXP7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
GLMN (NM_053274) Human Tagged ORF Clone Lentiviral Particle
RC201521L2V 200 µL

GLMN (NM_053274) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TST antibody
70R-12972 100 ul

TST antibody

Sign In for Pricing
View Details
Immp1l Mouse shRNA Plasmid (Locus ID 66541)
TR512331 1 Kit

Immp1l Mouse shRNA Plasmid (Locus ID 66541)

Sign In for Pricing
View Details