Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AG-2, Mouse (HEK293, His)

AG-2 protein is essential for the post-transcriptional synthesis and secretion of MUC2, a key component of mucus.It plays an important role in intestinal cell mucus production and is considered a proto-oncogene with potential effects on cell migration, differentiation and growth.AG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived AG-2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AG-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ag-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Molecular Formula

23795 (Gene_ID) O88312 (K21-L175) (Accession)

Molecular Weight

Approximately 20-22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adiponectin (ADIPOQ) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B2]
TA503801AM 100 µL

Adiponectin (ADIPOQ) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B2]

Sign In for Pricing
View Details
Caspase-9 (1-2) PE
sc-56073 PE 200 µg/mL

Caspase-9 (1-2) PE

Sign In for Pricing
View Details
EMX1 antibody - middle region
MBS3208620-01 0.1 mL

EMX1 antibody - middle region

Sign In for Pricing
View Details
EMX1 antibody - middle region
MBS3208620-02 5x 0.1 mL

EMX1 antibody - middle region

Sign In for Pricing
View Details
Ociad1 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6609203 1.0 µg DNA

Ociad1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
TJP2 Polyclonal Antibody
CAC15804-01 50 µL

TJP2 Polyclonal Antibody

Sign In for Pricing
View Details