Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AG-2, Mouse (HEK293, His)

AG-2 protein is essential for the post-transcriptional synthesis and secretion of MUC2, a key component of mucus.It plays an important role in intestinal cell mucus production and is considered a proto-oncogene with potential effects on cell migration, differentiation and growth.AG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived AG-2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AG-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ag-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Molecular Formula

23795 (Gene_ID) O88312 (K21-L175) (Accession)

Molecular Weight

Approximately 20-22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Herpes Simplex Virus 1 (HSV1) ICP8 Antibody (11E2) [Alexa Fluor 647]
NB100-2771AF647 0.1 mL

Mouse Monoclonal Herpes Simplex Virus 1 (HSV1) ICP8 Antibody (11E2) [Alexa Fluor 647]

Sign In for Pricing
View Details
SB-408124 HCl 10mg
A15231-10 10 mg

SB-408124 HCl 10mg

Sign In for Pricing
View Details
Olr67 (NM_001001279) Rat Untagged Clone
RN206275 10 µg

Olr67 (NM_001001279) Rat Untagged Clone

Sign In for Pricing
View Details
AF/LE Purified Anti-Human CD5 Antibody [HISM2]
MBS2579659-01 0.05 mg

AF/LE Purified Anti-Human CD5 Antibody [HISM2]

Sign In for Pricing
View Details
AF/LE Purified Anti-Human CD5 Antibody [HISM2]
MBS2579659-02 0.5 mg

AF/LE Purified Anti-Human CD5 Antibody [HISM2]

Sign In for Pricing
View Details
AF/LE Purified Anti-Human CD5 Antibody [HISM2]
MBS2579659-03 1 mg

AF/LE Purified Anti-Human CD5 Antibody [HISM2]

Sign In for Pricing
View Details