Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AG-2, Mouse (HEK293, His)

AG-2 protein is essential for the post-transcriptional synthesis and secretion of MUC2, a key component of mucus.It plays an important role in intestinal cell mucus production and is considered a proto-oncogene with potential effects on cell migration, differentiation and growth.AG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived AG-2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AG-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ag-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Molecular Formula

23795 (Gene_ID) O88312 (K21-L175) (Accession)

Molecular Weight

Approximately 20-22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP2W1 (NM_017781) Human Mass Spec Standard
PH306472 10 µg

CYP2W1 (NM_017781) Human Mass Spec Standard

Sign In for Pricing
View Details
Fam57b (NM_001106296) Rat Tagged Lenti ORF Clone
RR212436L4 10 µg

Fam57b (NM_001106296) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PACAP-38 (31-38), human, mouse, rat 5mg
A22828-5 5 mg

PACAP-38 (31-38), human, mouse, rat 5mg

Sign In for Pricing
View Details
Recombinant Erwinia carotovora subsp. atroseptica Acetylornithine deacetylase (argE)
MBS1447468-01 0.02 mg (E-Coli)

Recombinant Erwinia carotovora subsp. atroseptica Acetylornithine deacetylase (argE)

Sign In for Pricing
View Details
Recombinant Erwinia carotovora subsp. atroseptica Acetylornithine deacetylase (argE)
MBS1447468-02 0.02 mg (Yeast)

Recombinant Erwinia carotovora subsp. atroseptica Acetylornithine deacetylase (argE)

Sign In for Pricing
View Details
Recombinant Erwinia carotovora subsp. atroseptica Acetylornithine deacetylase (argE)
MBS1447468-03 0.1 mg (E-Coli)

Recombinant Erwinia carotovora subsp. atroseptica Acetylornithine deacetylase (argE)

Sign In for Pricing
View Details