Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AG-2, Mouse (HEK293, His)

AG-2 protein is essential for the post-transcriptional synthesis and secretion of MUC2, a key component of mucus.It plays an important role in intestinal cell mucus production and is considered a proto-oncogene with potential effects on cell migration, differentiation and growth.AG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived AG-2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AG-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ag-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Molecular Formula

23795 (Gene_ID) O88312 (K21-L175) (Accession)

Molecular Weight

Approximately 20-22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRALBP (RLBP1) Human shRNA Plasmid Kit (Locus ID 6017)
TR309807 1 Kit

CRALBP (RLBP1) Human shRNA Plasmid Kit (Locus ID 6017)

Sign In for Pricing
View Details
RPL30P12 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV779459 1.0 µg DNA

RPL30P12 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Paip1 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6112702 1.0 µg DNA

Paip1 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Mouse Monoclonal BMPR-II Antibody (MM0060-9A10) [Biotin]
NBP2-12064B 0.1 mL

Mouse Monoclonal BMPR-II Antibody (MM0060-9A10) [Biotin]

Sign In for Pricing
View Details
Human PIGR (Polymeric Immunoglobulin Receptor) ELISA Kit
EK241264 96 Well

Human PIGR (Polymeric Immunoglobulin Receptor) ELISA Kit

Sign In for Pricing
View Details
Tiparp-set siRNA/shRNA/RNAi Lentivector (Mouse)
46737094 4x 500 ng

Tiparp-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details