Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AG-2, Mouse (HEK293, His)

AG-2 protein is essential for the post-transcriptional synthesis and secretion of MUC2, a key component of mucus.It plays an important role in intestinal cell mucus production and is considered a proto-oncogene with potential effects on cell migration, differentiation and growth.AG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived AG-2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AG-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ag-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Molecular Formula

23795 (Gene_ID) O88312 (K21-L175) (Accession)

Molecular Weight

Approximately 20-22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CSK sgRNA gene knockout kit - Lentiviral human CSK sgRNA gene knockout kit (plasmid)
GTR15362936 1 Vial

Lentiviral human CSK sgRNA gene knockout kit - Lentiviral human CSK sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Rabbit Anti-Histone H2B/H2BC5 Polyclonal Antibody
PAV7903 100 μL

Rabbit Anti-Histone H2B/H2BC5 Polyclonal Antibody

Sign In for Pricing
View Details
LRP1 CRISPR Activation Plasmid (h)
sc-400638-ACT 20 µg

LRP1 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Mouse Monoclonal Melanopsin Antibody (628737) [HRP]
FAB10497H 0.1 mL

Mouse Monoclonal Melanopsin Antibody (628737) [HRP]

Sign In for Pricing
View Details
Aceclofenac-d2
440765-01 10 mg

Aceclofenac-d2

Sign In for Pricing
View Details
Aceclofenac-d2
440765-02 100 mg

Aceclofenac-d2

Sign In for Pricing
View Details