Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AG-2, Mouse (HEK293, His)

AG-2 protein is essential for the post-transcriptional synthesis and secretion of MUC2, a key component of mucus.It plays an important role in intestinal cell mucus production and is considered a proto-oncogene with potential effects on cell migration, differentiation and growth.AG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived AG-2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AG-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ag-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Molecular Formula

23795 (Gene_ID) O88312 (K21-L175) (Accession)

Molecular Weight

Approximately 20-22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANKRD20B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
52769111 3x 1.0 µg

ANKRD20B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
C15orf29 sgRNA CRISPR Lentivector set (Human)
K0307001 3x 1.0 µg

C15orf29 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
KM 11060 100mg
A15843-100 100 mg

KM 11060 100mg

Sign In for Pricing
View Details
TMEM26 (Biotin)
579365-01 50 µg

TMEM26 (Biotin)

Sign In for Pricing
View Details
TMEM26 (Biotin)
579365-02 100 µg

TMEM26 (Biotin)

Sign In for Pricing
View Details
CALR3 protein (His tag)
80R-3706 100 ug

CALR3 protein (His tag)

Sign In for Pricing
View Details