Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AG-2, Mouse (HEK293, His)

AG-2 protein is essential for the post-transcriptional synthesis and secretion of MUC2, a key component of mucus.It plays an important role in intestinal cell mucus production and is considered a proto-oncogene with potential effects on cell migration, differentiation and growth.AG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived AG-2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AG-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ag-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Molecular Formula

23795 (Gene_ID) O88312 (K21-L175) (Accession)

Molecular Weight

Approximately 20-22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMGB4 Antibody
A40640-100UL 100 µL

HMGB4 Antibody

Sign In for Pricing
View Details
16-Ketoestradiol
MF-0054400-01 10 mg

16-Ketoestradiol

Sign In for Pricing
View Details
16-Ketoestradiol
MF-0054400-02 50 mg

16-Ketoestradiol

Sign In for Pricing
View Details
Rabbit Polyclonal rpmB/L28 Antibody [mFluor Violet 450 SE]
NBP3-23513MFV450 0.1 mL

Rabbit Polyclonal rpmB/L28 Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Vps37c (NM_001107463) Rat Untagged Clone
RN201829 10 µg

Vps37c (NM_001107463) Rat Untagged Clone

Sign In for Pricing
View Details
Recombinant Brucella Abortus rpsS Protein (strain S19) (aa 1-92)
VAng-Lsx4811-50gEcoli 50 µg (E. coli)

Recombinant Brucella Abortus rpsS Protein (strain S19) (aa 1-92)

Sign In for Pricing
View Details