Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AG-2, Mouse (HEK293, His)

AG-2 protein is essential for the post-transcriptional synthesis and secretion of MUC2, a key component of mucus.It plays an important role in intestinal cell mucus production and is considered a proto-oncogene with potential effects on cell migration, differentiation and growth.AG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived AG-2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AG-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ag-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Molecular Formula

23795 (Gene_ID) O88312 (K21-L175) (Accession)

Molecular Weight

Approximately 20-22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tricrozarin A
MF-0126075-01 10 mg

Tricrozarin A

Sign In for Pricing
View Details
Tricrozarin A
MF-0126075-02 50 mg

Tricrozarin A

Sign In for Pricing
View Details
URG4, ID (URGCP, KIAA1507, URG4, Up-regulator of cell proliferation, HBV X protein up-regulated gene 4 protein, HBxAg up-regulated gene 4 protein) (MaxLight 650) discontinued
043645-ML650 100 µL

URG4, ID (URGCP, KIAA1507, URG4, Up-regulator of cell proliferation, HBV X protein up-regulated gene 4 protein, HBxAg up-regulated gene 4 protein) (MaxLight 650) discontinued

Sign In for Pricing
View Details
RBMY1A1 Protein Vector (Mouse) (pPB-N-His)
PV223071 500 ng

RBMY1A1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
hsa-miR-6720-5p miRNA Agomir
MBS8312810-01 5 nmol

hsa-miR-6720-5p miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-6720-5p miRNA Agomir
MBS8312810-02 10 nmol

hsa-miR-6720-5p miRNA Agomir

Sign In for Pricing
View Details