Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AG-2, Mouse (HEK293, His)

AG-2 protein is essential for the post-transcriptional synthesis and secretion of MUC2, a key component of mucus.It plays an important role in intestinal cell mucus production and is considered a proto-oncogene with potential effects on cell migration, differentiation and growth.AG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived AG-2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AG-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ag-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Molecular Formula

23795 (Gene_ID) O88312 (K21-L175) (Accession)

Molecular Weight

Approximately 20-22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CLDN3/4 Antibody , PerCP
E55A08977 50 Tests

Human CLDN3/4 Antibody , PerCP

Sign In for Pricing
View Details
Itln1 (NM_010584) Mouse Untagged Clone
MC208797 10 µg

Itln1 (NM_010584) Mouse Untagged Clone

Sign In for Pricing
View Details
Rabbit anti-Oryza sativa subsp. japonica (Rice) TB1 Polyclonal Antibody
MBS7144517 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) TB1 Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-CREB-1 (Ser133) Recombinant Antibody, APC-Cy7 Conjugated
bsm-61105R-APC-Cy7 100 µL

Phospho-CREB-1 (Ser133) Recombinant Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
NEK2 Antibody
A49877-100UL 100 µL

NEK2 Antibody

Sign In for Pricing
View Details
SCN8A (Sodium Channel Protein Type 8 Subunit alpha, Sodium Channel Protein Type VIII Subunit alpha, Voltage-gated Sodium Channel Subunit alpha Nav1.6, SCN8A, MED)
407080-01 50 µL

SCN8A (Sodium Channel Protein Type 8 Subunit alpha, Sodium Channel Protein Type VIII Subunit alpha, Voltage-gated Sodium Channel Subunit alpha Nav1.6, SCN8A, MED)

Sign In for Pricing
View Details