Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AG-2, Mouse (HEK293, His)

AG-2 protein is essential for the post-transcriptional synthesis and secretion of MUC2, a key component of mucus.It plays an important role in intestinal cell mucus production and is considered a proto-oncogene with potential effects on cell migration, differentiation and growth.AG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived AG-2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AG-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ag-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Molecular Formula

23795 (Gene_ID) O88312 (K21-L175) (Accession)

Molecular Weight

Approximately 20-22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLPI Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV670542 1.0 µg DNA

SLPI Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
HYI (Hydroxypyruvate Isomerase Homolog (E. coli), HT036, MGC20767)
247345 50 µL

HYI (Hydroxypyruvate Isomerase Homolog (E. coli), HT036, MGC20767)

Sign In for Pricing
View Details
Tor4a (NM_001107816) Rat Tagged Lenti ORF Clone
RR206692L4 10 µg

Tor4a (NM_001107816) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
D54 discontinued
342880-01 100 µL

D54 discontinued

Sign In for Pricing
View Details
D54 discontinued
342880-02 200 µL

D54 discontinued

Sign In for Pricing
View Details
Human Pyruvate Kinase (M2-PK) ELISA Kit
RK07037 96 Tests

Human Pyruvate Kinase (M2-PK) ELISA Kit

Sign In for Pricing
View Details