Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AG-2, Mouse (HEK293, His)

AG-2 protein is essential for the post-transcriptional synthesis and secretion of MUC2, a key component of mucus.It plays an important role in intestinal cell mucus production and is considered a proto-oncogene with potential effects on cell migration, differentiation and growth.AG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived AG-2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AG-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ag-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Molecular Formula

23795 (Gene_ID) O88312 (K21-L175) (Accession)

Molecular Weight

Approximately 20-22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTPBP2 Rabbit Polyclonal Antibody
TA366598 100 µL

GTPBP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bird Interleukin 2,IL-2 ELISA KIT
JOT-EK0221Bi 96 wells

Bird Interleukin 2,IL-2 ELISA KIT

Sign In for Pricing
View Details
HAV-IgM CE Hepatitis A IgA Antibody ELISA test
74 96T/Box

HAV-IgM CE Hepatitis A IgA Antibody ELISA test

Sign In for Pricing
View Details
YWHAZP3 sgRNA CRISPR Lentivector (Human) (Target 2)
K2658403 1.0 µg DNA

YWHAZP3 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
SPIRE1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV701823 1.0 µg DNA

SPIRE1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant Cheiromeles parvidens NADH-ubiquinone oxidoreductase chain 2 (MT-ND2), partial
MBS7077767 Inquire

Recombinant Cheiromeles parvidens NADH-ubiquinone oxidoreductase chain 2 (MT-ND2), partial

Sign In for Pricing
View Details