Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AG-2, Mouse (HEK293, His)

AG-2 protein is essential for the post-transcriptional synthesis and secretion of MUC2, a key component of mucus.It plays an important role in intestinal cell mucus production and is considered a proto-oncogene with potential effects on cell migration, differentiation and growth.AG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived AG-2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AG-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ag-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Molecular Formula

23795 (Gene_ID) O88312 (K21-L175) (Accession)

Molecular Weight

Approximately 20-22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human OSBP shRNA (UAS) - Lentiviral human OSBP shRNA (UAS) (25)
GTR15161249 1 Vial

Lentiviral human OSBP shRNA (UAS) - Lentiviral human OSBP shRNA (UAS) (25)

Sign In for Pricing
View Details
TTC29 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV659989 1.0 µg DNA

TTC29 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
DDX5 antibody (Tyr593)
70R-33554 100 ug

DDX5 antibody (Tyr593)

Sign In for Pricing
View Details
C20orf166 (MIR1-1HG) (NM_178463) Human Over-expression Lysate
LS128826-100ug 100 µg

C20orf166 (MIR1-1HG) (NM_178463) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human TNFAIP8L2
P2147-01 50 µg

Recombinant Human TNFAIP8L2

Sign In for Pricing
View Details
Recombinant Human TNFAIP8L2
P2147-02 200 µg

Recombinant Human TNFAIP8L2

Sign In for Pricing
View Details