Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AG-2, Mouse (HEK293, His)

AG-2 protein is essential for the post-transcriptional synthesis and secretion of MUC2, a key component of mucus.It plays an important role in intestinal cell mucus production and is considered a proto-oncogene with potential effects on cell migration, differentiation and growth.AG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived AG-2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AG-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ag-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Molecular Formula

23795 (Gene_ID) O88312 (K21-L175) (Accession)

Molecular Weight

Approximately 20-22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KDELR2 CytoSection
TS400007P5 25 Slides

KDELR2 CytoSection

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) SPCC777.12c Polyclonal Antibody
MBS7183677 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) SPCC777.12c Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Occludin Antibody (rOCLN/8776) [Alexa Fluor 700]
NBP3-20880AF700 0.1 mL

Mouse Monoclonal Occludin Antibody (rOCLN/8776) [Alexa Fluor 700]

Sign In for Pricing
View Details
MAP1D, NT (METAP1D, MAP1D, Methionine aminopeptidase 1D, mitochondrial, Methionyl aminopeptidase type 1D, mitochondrial)
038097 200 µL

MAP1D, NT (METAP1D, MAP1D, Methionine aminopeptidase 1D, mitochondrial, Methionyl aminopeptidase type 1D, mitochondrial)

Sign In for Pricing
View Details
BRCA1 Rabbit Polyclonal Antibody
TA383831 100 µL

BRCA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human ZNF496 qPCR Primer Pair
QH56565S 200 Tests

Human ZNF496 qPCR Primer Pair

Sign In for Pricing
View Details