Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AG-2, Mouse (HEK293, His)

AG-2 protein is essential for the post-transcriptional synthesis and secretion of MUC2, a key component of mucus.It plays an important role in intestinal cell mucus production and is considered a proto-oncogene with potential effects on cell migration, differentiation and growth.AG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived AG-2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AG-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ag-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Molecular Formula

23795 (Gene_ID) O88312 (K21-L175) (Accession)

Molecular Weight

Approximately 20-22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB2A
pro-244 5µg

RAB2A

Sign In for Pricing
View Details
Vmn1r32 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4032807 1.0 µg DNA

Vmn1r32 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
PCOLCE Rabbit Polyclonal Antibody
TA379703 100 µL

PCOLCE Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SUPT20HL2 Human Gene Knockout Kit (CRISPR)
KN427305 1 Kit

SUPT20HL2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rabbit Anti Rat Ferritin Polyclonal Antibody
CPBT-66109RR 0.2ml

Rabbit Anti Rat Ferritin Polyclonal Antibody

Sign In for Pricing
View Details
17-Hydroxypregn-​4-​en-​3-​one
H950645 1 mg

17-Hydroxypregn-​4-​en-​3-​one

Sign In for Pricing
View Details