Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AG-2, Mouse (HEK293, His)

AG-2 protein is essential for the post-transcriptional synthesis and secretion of MUC2, a key component of mucus.It plays an important role in intestinal cell mucus production and is considered a proto-oncogene with potential effects on cell migration, differentiation and growth.AG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived AG-2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AG-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ag-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Molecular Formula

23795 (Gene_ID) O88312 (K21-L175) (Accession)

Molecular Weight

Approximately 20-22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

pNiFty3-IAN-SEAP
pnf3-sp7 20 µg

pNiFty3-IAN-SEAP

Sign In for Pricing
View Details
Sag sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3711008 1.0 µg DNA

Sag sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Probable carboxypeptidase X1 (CPXM1) Human ELISA Kit
G1032 96 Tests

Probable carboxypeptidase X1 (CPXM1) Human ELISA Kit

Sign In for Pricing
View Details
Synuclein, alpha, beta, nitrated (Tyr39)
MBS603874-01 0.2 mL

Synuclein, alpha, beta, nitrated (Tyr39)

Sign In for Pricing
View Details
Synuclein, alpha, beta, nitrated (Tyr39)
MBS603874-02 5x 0.2 mL

Synuclein, alpha, beta, nitrated (Tyr39)

Sign In for Pricing
View Details
Recombinant Human NR5A2, N-His
MBS1572463-01 0.1 mg

Recombinant Human NR5A2, N-His

Sign In for Pricing
View Details