Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AG-2, Mouse (HEK293, His)

AG-2 protein is essential for the post-transcriptional synthesis and secretion of MUC2, a key component of mucus.It plays an important role in intestinal cell mucus production and is considered a proto-oncogene with potential effects on cell migration, differentiation and growth.AG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived AG-2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AG-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ag-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Molecular Formula

23795 (Gene_ID) O88312 (K21-L175) (Accession)

Molecular Weight

Approximately 20-22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SRp55 Antibody
NBP2-04142 100 µL

Rabbit Polyclonal SRp55 Antibody

Sign In for Pricing
View Details
CD207 Rabbit pAb
MBS8546185-01 0.1 mL

CD207 Rabbit pAb

Sign In for Pricing
View Details
CD207 Rabbit pAb
MBS8546185-02 0.1 mL (AF405L)

CD207 Rabbit pAb

Sign In for Pricing
View Details
CD207 Rabbit pAb
MBS8546185-03 0.1 mL (AF405S)

CD207 Rabbit pAb

Sign In for Pricing
View Details
CD207 Rabbit pAb
MBS8546185-04 0.1 mL (AF610)

CD207 Rabbit pAb

Sign In for Pricing
View Details
CD207 Rabbit pAb
MBS8546185-05 0.1 mL (AF635)

CD207 Rabbit pAb

Sign In for Pricing
View Details