Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AG-2, Mouse (HEK293, His)

AG-2 protein is essential for the post-transcriptional synthesis and secretion of MUC2, a key component of mucus.It plays an important role in intestinal cell mucus production and is considered a proto-oncogene with potential effects on cell migration, differentiation and growth.AG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived AG-2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AG-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ag-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Molecular Formula

23795 (Gene_ID) O88312 (K21-L175) (Accession)

Molecular Weight

Approximately 20-22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SR-1F (5-hydroxytryptamine Receptor 1F, 5-HT-1F, 5-HT1F, Serotonin Receptor 1F, HTR1F, HTR1EL) discontinued
226009-01 50 µL

SR-1F (5-hydroxytryptamine Receptor 1F, 5-HT-1F, 5-HT1F, Serotonin Receptor 1F, HTR1F, HTR1EL) discontinued

Sign In for Pricing
View Details
SR-1F (5-hydroxytryptamine Receptor 1F, 5-HT-1F, 5-HT1F, Serotonin Receptor 1F, HTR1F, HTR1EL) discontinued
226009-02 100 µL

SR-1F (5-hydroxytryptamine Receptor 1F, 5-HT-1F, 5-HT1F, Serotonin Receptor 1F, HTR1F, HTR1EL) discontinued

Sign In for Pricing
View Details
KCNJ6, ID (KCNJ6, GIRK2, KATP2, KCNJ7, G protein-activated inward rectifier potassium channel 2, BIR1, Inward rectifier K(+) channel Kir3.2, KATP-2, Potassium channel, inwardly rectifying subfamily J member 6) (MaxLight 405)
MBS6312582-01 0.1 mL

KCNJ6, ID (KCNJ6, GIRK2, KATP2, KCNJ7, G protein-activated inward rectifier potassium channel 2, BIR1, Inward rectifier K(+) channel Kir3.2, KATP-2, Potassium channel, inwardly rectifying subfamily J member 6) (MaxLight 405)

Sign In for Pricing
View Details
KCNJ6, ID (KCNJ6, GIRK2, KATP2, KCNJ7, G protein-activated inward rectifier potassium channel 2, BIR1, Inward rectifier K(+) channel Kir3.2, KATP-2, Potassium channel, inwardly rectifying subfamily J member 6) (MaxLight 405)
MBS6312582-02 5x 0.1 mL

KCNJ6, ID (KCNJ6, GIRK2, KATP2, KCNJ7, G protein-activated inward rectifier potassium channel 2, BIR1, Inward rectifier K(+) channel Kir3.2, KATP-2, Potassium channel, inwardly rectifying subfamily J member 6) (MaxLight 405)

Sign In for Pricing
View Details
Cdc6 Rat shRNA Plasmid (Locus ID 360621)
TL706836 1 Kit

Cdc6 Rat shRNA Plasmid (Locus ID 360621)

Sign In for Pricing
View Details
LHX2 Mouse Monoclonal Antibody [Clone ID: OTI2H2]
TA810303S 30 µL

LHX2 Mouse Monoclonal Antibody [Clone ID: OTI2H2]

Sign In for Pricing
View Details