Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AG-2, Mouse (HEK293, His)

AG-2 protein is essential for the post-transcriptional synthesis and secretion of MUC2, a key component of mucus.It plays an important role in intestinal cell mucus production and is considered a proto-oncogene with potential effects on cell migration, differentiation and growth.AG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived AG-2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AG-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ag-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Molecular Formula

23795 (Gene_ID) O88312 (K21-L175) (Accession)

Molecular Weight

Approximately 20-22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC144NL CytoSection
TS409886P5 25 Slides

CCDC144NL CytoSection

Sign In for Pricing
View Details
Slc25a47 (NM_001001509) Rat Tagged ORF Clone Lentiviral Particle
RR209984L4V 200 µL

Slc25a47 (NM_001001509) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Human GTPase ERas Protein, His, E.coli-200ug
QP8776-ec-200ug 200ug

Recombinant Human GTPase ERas Protein, His, E.coli-200ug

Sign In for Pricing
View Details
B-Cell leukemia/lymphoma 3 (Bcl-3) Rat ELISA Kit
B8194 96 Tests

B-Cell leukemia/lymphoma 3 (Bcl-3) Rat ELISA Kit

Sign In for Pricing
View Details
Olr1295 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7435608 1.0 µg DNA

Olr1295 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Mouse PRF1 (Perforin 1) ELISA Kit
RE3020M-01 48 Tests

Mouse PRF1 (Perforin 1) ELISA Kit

Sign In for Pricing
View Details