Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AG-2, Mouse (HEK293, His)

AG-2 protein is essential for the post-transcriptional synthesis and secretion of MUC2, a key component of mucus.It plays an important role in intestinal cell mucus production and is considered a proto-oncogene with potential effects on cell migration, differentiation and growth.AG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived AG-2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AG-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ag-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Molecular Formula

23795 (Gene_ID) O88312 (K21-L175) (Accession)

Molecular Weight

Approximately 20-22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Leucyl-tRNA synthetase, cytoplasmic, LARS ELISA KIT
ELI-39607h 96 Tests

Human Leucyl-tRNA synthetase, cytoplasmic, LARS ELISA KIT

Sign In for Pricing
View Details
Phospho-BLNK (Tyr96) Colorimetric Cell-Based ELISA Kit
MBS9501183-01 1 Kit

Phospho-BLNK (Tyr96) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
Phospho-BLNK (Tyr96) Colorimetric Cell-Based ELISA Kit
MBS9501183-02 5x 1 Kit

Phospho-BLNK (Tyr96) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
Human APRIL/TNFSF13 Recombinant Protein Fc Tag Lyophilized
MBS8431248 Inquire

Human APRIL/TNFSF13 Recombinant Protein Fc Tag Lyophilized

Sign In for Pricing
View Details
Vmn1r95 3'UTR GFP Stable Cell Line
TU171984 1.0 mL

Vmn1r95 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rat Anti Human Cd3 Monoclonal Antibody,FITC
CABT-48630RH 0.1 mg

Rat Anti Human Cd3 Monoclonal Antibody,FITC

Sign In for Pricing
View Details