Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AG-2, Mouse (HEK293, His)

AG-2 protein is essential for the post-transcriptional synthesis and secretion of MUC2, a key component of mucus.It plays an important role in intestinal cell mucus production and is considered a proto-oncogene with potential effects on cell migration, differentiation and growth.AG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived AG-2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AG-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ag-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Molecular Formula

23795 (Gene_ID) O88312 (K21-L175) (Accession)

Molecular Weight

Approximately 20-22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Efcab14 qPCR Primer Pair
QM59298S 200 Tests

Mouse Efcab14 qPCR Primer Pair

Sign In for Pricing
View Details
Anti-RAPH1 Antibody
CPA3079-01 30 µL

Anti-RAPH1 Antibody

Sign In for Pricing
View Details
Anti-RAPH1 Antibody
CPA3079-02 50 μL

Anti-RAPH1 Antibody

Sign In for Pricing
View Details
Anti-RAPH1 Antibody
CPA3079-03 100 µL

Anti-RAPH1 Antibody

Sign In for Pricing
View Details
Anti-RAPH1 Antibody
CPA3079-04 200 µL

Anti-RAPH1 Antibody

Sign In for Pricing
View Details
anti-TSC22D4
YF-PA21173 50 ul

anti-TSC22D4

Sign In for Pricing
View Details