Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AG-2, Mouse (HEK293, His)

AG-2 protein is essential for the post-transcriptional synthesis and secretion of MUC2, a key component of mucus.It plays an important role in intestinal cell mucus production and is considered a proto-oncogene with potential effects on cell migration, differentiation and growth.AG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived AG-2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AG-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ag-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Molecular Formula

23795 (Gene_ID) O88312 (K21-L175) (Accession)

Molecular Weight

Approximately 20-22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-Met Monoclonal Antibody, PE Conjugated
bsm-34234R-PE 100 µL

C-Met Monoclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Ago4 (NM_001106686) Rat Untagged Clone
RN215671 10 µg

Ago4 (NM_001106686) Rat Untagged Clone

Sign In for Pricing
View Details
Tuba1a Mouse shRNA Lentiviral Particle (Locus ID 22142)
TL502348V 500 µL Each

Tuba1a Mouse shRNA Lentiviral Particle (Locus ID 22142)

Sign In for Pricing
View Details
Recombinant Human IL-21 (HEK293 Expressed) Protein CF
11393-IL-010 10 µg

Recombinant Human IL-21 (HEK293 Expressed) Protein CF

Sign In for Pricing
View Details
Human EIF4E shRNA Plasmid
abx951367-01 150 µg

Human EIF4E shRNA Plasmid

Sign In for Pricing
View Details
Human EIF4E shRNA Plasmid
abx951367-02 300 µg

Human EIF4E shRNA Plasmid

Sign In for Pricing
View Details