Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AG-2, Mouse (HEK293, His)

AG-2 protein is essential for the post-transcriptional synthesis and secretion of MUC2, a key component of mucus.It plays an important role in intestinal cell mucus production and is considered a proto-oncogene with potential effects on cell migration, differentiation and growth.AG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived AG-2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AG-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ag-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Molecular Formula

23795 (Gene_ID) O88312 (K21-L175) (Accession)

Molecular Weight

Approximately 20-22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Crotonyl-Histone H4 (Lys5) Recombinant Rabbit mAb
BS43431-01 50 µL

Crotonyl-Histone H4 (Lys5) Recombinant Rabbit mAb

Sign In for Pricing
View Details
Crotonyl-Histone H4 (Lys5) Recombinant Rabbit mAb
BS43431-02 100 µL

Crotonyl-Histone H4 (Lys5) Recombinant Rabbit mAb

Sign In for Pricing
View Details
LOC691921 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV649376 1.0 µg DNA

LOC691921 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
OR7E22P Protein Vector (Human) (pPM-C-His)
PV108617 500 ng

OR7E22P Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Research Grade Anti-Human CD309/VEGFR2 Antibody (BC001)
DHE16611 100 μg

Research Grade Anti-Human CD309/VEGFR2 Antibody (BC001)

Sign In for Pricing
View Details
MC-GGFG-PAB-Exatecan
HY-160967-01 5 mg

MC-GGFG-PAB-Exatecan

Sign In for Pricing
View Details