Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AG-2, Mouse (HEK293, His)

AG-2 protein is essential for the post-transcriptional synthesis and secretion of MUC2, a key component of mucus.It plays an important role in intestinal cell mucus production and is considered a proto-oncogene with potential effects on cell migration, differentiation and growth.AG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived AG-2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AG-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ag-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Molecular Formula

23795 (Gene_ID) O88312 (K21-L175) (Accession)

Molecular Weight

Approximately 20-22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Mouse anti-Human IgG3 Secondary Antibody (5G12) [DyLight 405]
NB100-1599V 0.2 mL

Mouse Monoclonal Mouse anti-Human IgG3 Secondary Antibody (5G12) [DyLight 405]

Sign In for Pricing
View Details
ZFP64 Recombinant Protein Antigen
NBP1-85171PEP 0.1 mL

ZFP64 Recombinant Protein Antigen

Sign In for Pricing
View Details
SULT2B1 Monoclonal Antibody
bsm-51745M 100 µL

SULT2B1 Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Hexanoyl-Lysine adduct Antibody (5D9) [PE/Cy5.5]
NBP2-59362PECY55 0.1 mL

Mouse Monoclonal Hexanoyl-Lysine adduct Antibody (5D9) [PE/Cy5.5]

Sign In for Pricing
View Details
Ppp1r18 Rat shRNA Plasmid (Locus ID 361790)
TR708333 1 Kit

Ppp1r18 Rat shRNA Plasmid (Locus ID 361790)

Sign In for Pricing
View Details
Recombinant Human Hypoxanthine-Guanine Phosphoribosyltransferase
MBS144004-01 0.005 mg

Recombinant Human Hypoxanthine-Guanine Phosphoribosyltransferase

Sign In for Pricing
View Details