Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AG-2, Mouse (HEK293, His)

AG-2 protein is essential for the post-transcriptional synthesis and secretion of MUC2, a key component of mucus.It plays an important role in intestinal cell mucus production and is considered a proto-oncogene with potential effects on cell migration, differentiation and growth.AG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived AG-2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AG-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ag-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Molecular Formula

23795 (Gene_ID) O88312 (K21-L175) (Accession)

Molecular Weight

Approximately 20-22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

A Disintegrin And Metalloprotease 10 (ADAM10)
138996 200 µL

A Disintegrin And Metalloprotease 10 (ADAM10)

Sign In for Pricing
View Details
Lentiviral human MRVI1 shRNA (UAS) - Lentiviral human MRVI1 shRNA (UAS, GFP) (25)
GTR15315563 1 Vial

Lentiviral human MRVI1 shRNA (UAS) - Lentiviral human MRVI1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Rat Glycoprotein Ib Beta Polypeptide, Platelet (GP1Bb) Antibody Pair Kit (with Standard)
MBS2099787-01 5x 96 Tests

Rat Glycoprotein Ib Beta Polypeptide, Platelet (GP1Bb) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Glycoprotein Ib Beta Polypeptide, Platelet (GP1Bb) Antibody Pair Kit (with Standard)
MBS2099787-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Rat Glycoprotein Ib Beta Polypeptide, Platelet (GP1Bb) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Glycoprotein Ib Beta Polypeptide, Platelet (GP1Bb) Antibody Pair Kit (with Standard)
MBS2099787-03 10x 96 Tests

Rat Glycoprotein Ib Beta Polypeptide, Platelet (GP1Bb) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Glycoprotein Ib Beta Polypeptide, Platelet (GP1Bb) Antibody Pair Kit (with Standard)
MBS2099787-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Rat Glycoprotein Ib Beta Polypeptide, Platelet (GP1Bb) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details