Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AG-2, Mouse (HEK293, His)

AG-2 protein is essential for the post-transcriptional synthesis and secretion of MUC2, a key component of mucus.It plays an important role in intestinal cell mucus production and is considered a proto-oncogene with potential effects on cell migration, differentiation and growth.AG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived AG-2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AG-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ag-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Molecular Formula

23795 (Gene_ID) O88312 (K21-L175) (Accession)

Molecular Weight

Approximately 20-22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pan-Trk-IN-2
MBS5806143 Inquire

Pan-Trk-IN-2

Sign In for Pricing
View Details
Rat C19h19orf67 Pre-designed siRNA Set B
SI201669B 1 Each

Rat C19h19orf67 Pre-designed siRNA Set B

Sign In for Pricing
View Details
DRD5 sgRNA CRISPR Lentivector (Human) (Target 3)
K0632204 1.0 µg DNA

DRD5 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
NR2C2 (Nuclear Receptor Subfamily 2 Group C Member 2, Orphan Nuclear Receptor TAK1, Orphan Nuclear Receptor TR4, Testicular Receptor 4, TAK1, TR4) (MaxLight 405)
MBS6401499-01 0.1 mL

NR2C2 (Nuclear Receptor Subfamily 2 Group C Member 2, Orphan Nuclear Receptor TAK1, Orphan Nuclear Receptor TR4, Testicular Receptor 4, TAK1, TR4) (MaxLight 405)

Sign In for Pricing
View Details
NR2C2 (Nuclear Receptor Subfamily 2 Group C Member 2, Orphan Nuclear Receptor TAK1, Orphan Nuclear Receptor TR4, Testicular Receptor 4, TAK1, TR4) (MaxLight 405)
MBS6401499-02 5x 0.1 mL

NR2C2 (Nuclear Receptor Subfamily 2 Group C Member 2, Orphan Nuclear Receptor TAK1, Orphan Nuclear Receptor TR4, Testicular Receptor 4, TAK1, TR4) (MaxLight 405)

Sign In for Pricing
View Details
Rat Alpha 1, 6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A (MGAT5) ELISA Kit
MBS7224965-01 48 Well

Rat Alpha 1, 6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A (MGAT5) ELISA Kit

Sign In for Pricing
View Details