Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AG-2, Mouse (HEK293, His)

AG-2 protein is essential for the post-transcriptional synthesis and secretion of MUC2, a key component of mucus.It plays an important role in intestinal cell mucus production and is considered a proto-oncogene with potential effects on cell migration, differentiation and growth.AG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived AG-2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AG-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ag-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Molecular Formula

23795 (Gene_ID) O88312 (K21-L175) (Accession)

Molecular Weight

Approximately 20-22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Scara5 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6590204 1.0 µg DNA

Scara5 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
ATP8A2P3 Protein Vector (Human) (pPM-C-His)
PV064088 500 ng

ATP8A2P3 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Lentiviral human EVI5 shRNA (UAS) - Lentiviral human EVI5 shRNA (UAS, RFP) (100)
GTR15113124 1 Vial

Lentiviral human EVI5 shRNA (UAS) - Lentiviral human EVI5 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
10% SDS-PAGE Gel Kit
P1203-01 25 Tests

10% SDS-PAGE Gel Kit

Sign In for Pricing
View Details
10% SDS-PAGE Gel Kit
P1203-02 50 Tests

10% SDS-PAGE Gel Kit

Sign In for Pricing
View Details
Plekha1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4551502 1.0 µg DNA

Plekha1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details