Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APT-1/LYPLA1, Human (His)

The APT-1/LYPLA1 protein is an acylprotein thioesterase that hydrolyzes fatty acids from S-acylated cysteine residues in proteins, including G alpha proteins and HRAS. It also depalmitoylates KCNMA1 and potentially ADRB2 while acting as a lysophospholipase, hydrolyzing lysophosphatidylcholine (lyso-PC) and other lysophospholipids (lyso-PE, lyso-PI, lyso-PS) . APT-1/LYPLA1 Protein, Human (His) is the recombinant human-derived APT-1/LYPLA1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

APT-1/LYPLA1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apt-1-lypla1-protein-human-his.html

Purity

98.0

Smiles

MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPIDHHHHHH

Molecular Formula

10434 (Gene_ID) O75608 (M1-D230) (Accession)

Molecular Weight

Approximately 25.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GPR10 (PRLHR) activation kit by CRISPRa
GA101899 1 Kit

Human GPR10 (PRLHR) activation kit by CRISPRa

Sign In for Pricing
View Details
CEP97 Rabbit Polyclonal Antibody
TA361600 100 µL

CEP97 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TIGIT / VSTM3 / VSIG9 (Immune Checkpoint for Cancer) (TIGIT/3017), CF740 conjugate, 0.1mg/mL
BNC743017-500 1x 500 µL

TIGIT / VSTM3 / VSIG9 (Immune Checkpoint for Cancer) (TIGIT/3017), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N,N-Diisopropylethylamine
TRC-D493340-50G 50 g

N,N-Diisopropylethylamine

Sign In for Pricing
View Details
Silver(I) Fluoride
TRC-S465050-5G 5 g

Silver(I) Fluoride

Sign In for Pricing
View Details
Dibenzo[a,i]pyrene
TRC-D416985-10MG 10 mg

Dibenzo[a,i]pyrene

Sign In for Pricing
View Details