Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APT-1/LYPLA1, Human (His)

The APT-1/LYPLA1 protein is an acylprotein thioesterase that hydrolyzes fatty acids from S-acylated cysteine residues in proteins, including G alpha proteins and HRAS. It also depalmitoylates KCNMA1 and potentially ADRB2 while acting as a lysophospholipase, hydrolyzing lysophosphatidylcholine (lyso-PC) and other lysophospholipids (lyso-PE, lyso-PI, lyso-PS) . APT-1/LYPLA1 Protein, Human (His) is the recombinant human-derived APT-1/LYPLA1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

APT-1/LYPLA1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apt-1-lypla1-protein-human-his.html

Purity

98.0

Smiles

MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPIDHHHHHH

Molecular Formula

10434 (Gene_ID) O75608 (M1-D230) (Accession)

Molecular Weight

Approximately 25.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IL-22BP/IL-22RA2 Protein (His Tag)
PKSH033384-01 10 µg

Recombinant Human IL-22BP/IL-22RA2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IL-22BP/IL-22RA2 Protein (His Tag)
PKSH033384-02 50 µg

Recombinant Human IL-22BP/IL-22RA2 Protein (His Tag)

Sign In for Pricing
View Details
Vmn2r51 Mouse Gene Knockout Kit (CRISPR)
KN519181 1 Kit

Vmn2r51 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Col24a1 Mouse Gene Knockout Kit (CRISPR)
KN503629 1 Kit

Col24a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Naphthalenecarboxylic Acid-13C6
TRC-N345642-25MG 25 mg

2-Naphthalenecarboxylic Acid-13C6

Sign In for Pricing
View Details
α, ω-Bis-Bromo PEG
1120000-1.1G 1 g

α, ω-Bis-Bromo PEG

Sign In for Pricing
View Details