Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APT-1/LYPLA1, Human (His)

The APT-1/LYPLA1 protein is an acylprotein thioesterase that hydrolyzes fatty acids from S-acylated cysteine residues in proteins, including G alpha proteins and HRAS. It also depalmitoylates KCNMA1 and potentially ADRB2 while acting as a lysophospholipase, hydrolyzing lysophosphatidylcholine (lyso-PC) and other lysophospholipids (lyso-PE, lyso-PI, lyso-PS) . APT-1/LYPLA1 Protein, Human (His) is the recombinant human-derived APT-1/LYPLA1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

APT-1/LYPLA1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apt-1-lypla1-protein-human-his.html

Purity

98.0

Smiles

MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPIDHHHHHH

Molecular Formula

10434 (Gene_ID) O75608 (M1-D230) (Accession)

Molecular Weight

Approximately 25.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AFP-Luc (GFP) Lentivirus
LVP1035-G 1x 10^7 IFU/mL - 200 μL

AFP-Luc (GFP) Lentivirus

Sign In for Pricing
View Details
pDsRed2-Mito Plasmid
PVT1216 2 µg

pDsRed2-Mito Plasmid

Sign In for Pricing
View Details
TLR10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2380507 1.0 µg DNA

TLR10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Aglutin impurity 7 (Standard)
HY-I0296R 1 Each

Aglutin impurity 7 (Standard)

Sign In for Pricing
View Details
Mouse Hp Pre-designed siRNA Set A
SI106332A 1 Each

Mouse Hp Pre-designed siRNA Set A

Sign In for Pricing
View Details
All-in-One cDNA Synthesis SuperMix
B24408 1000 ractions

All-in-One cDNA Synthesis SuperMix

Sign In for Pricing
View Details