Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IFN-lambda 2/IL-28A, Mouse (His)

Animal-Free IFN-lambda 2/IL-28A Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIFN-lambda 2/IL-28A protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IFN-lambda 2/IL-28A Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ifn-lambda-2-il-28a-protein-mouse-his.html

Purity

98.00

Smiles

MDPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKDAIEKRLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENMTDSALATILGQPLHTLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFRLLTRDLKCVASGDQCV

Molecular Formula

330496 (Gene_ID) AAX58714.1 (D20-V193) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Acetamidobenzyl Alcohol
TRC-B400633-500MG 500 mg

4-Acetamidobenzyl Alcohol

Sign In for Pricing
View Details
Convicine-15N2,13C
TRC-C685097-2.5MG 2.5 mg

Convicine-15N2,13C

Sign In for Pricing
View Details
B230342M21Rik (BC019754) Mouse Tagged ORF Clone
MG200787 10 µg

B230342M21Rik (BC019754) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Frozen Tissue Blocks, Thyroid gland
CB554280 1 Block

Frozen Tissue Blocks, Thyroid gland

Sign In for Pricing
View Details
PDPN Mouse Monoclonal Antibody [Clone ID: OTI7B4]
CF811746 100 µg

PDPN Mouse Monoclonal Antibody [Clone ID: OTI7B4]

Sign In for Pricing
View Details
PEX11B Rabbit Monoclonal Antibody [Clone ID: R09-7B4]
TA421485 100 µL

PEX11B Rabbit Monoclonal Antibody [Clone ID: R09-7B4]

Sign In for Pricing
View Details