Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IFN-lambda 2/IL-28A, Mouse (His)

Animal-Free IFN-lambda 2/IL-28A Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIFN-lambda 2/IL-28A protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IFN-lambda 2/IL-28A Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ifn-lambda-2-il-28a-protein-mouse-his.html

Purity

98.00

Smiles

MDPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKDAIEKRLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENMTDSALATILGQPLHTLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFRLLTRDLKCVASGDQCV

Molecular Formula

330496 (Gene_ID) AAX58714.1 (D20-V193) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fkbp11 (BC022900) Mouse Tagged ORF Clone
MG200349 10 µg

Fkbp11 (BC022900) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
GFAP (NM_002055) Human Recombinant Protein
TP304548L 1 mg

GFAP (NM_002055) Human Recombinant Protein

Sign In for Pricing
View Details
NME1 / nm23-H1 / NDPK-A (Suppressor of Metastasis) (CPTC-NME1-2), CF740 conjugate, 0.1mg/mL
BNC742247-100 1x 100 µL

NME1 / nm23-H1 / NDPK-A (Suppressor of Metastasis) (CPTC-NME1-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79b (B-Cell Marker) (IGB/1844), CF647 conjugate, 0.1mg/mL
BNC471844-100 1x 100 µL

CD79b (B-Cell Marker) (IGB/1844), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(3S,4S)-(+)-1-Benzyl-3,4-pyrrolidinediol
TRC-B288805-500MG 500 mg

(3S,4S)-(+)-1-Benzyl-3,4-pyrrolidinediol

Sign In for Pricing
View Details
p38 (MAPK14) Rabbit Polyclonal Antibody
TA378306 100 µL

p38 (MAPK14) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details