Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-12 alpha, Human (His)

IL-35 protein plays a key role in immune regulation, forming IL-12 cytokine with IL12B or IL-35 cytokine with EBI3/IL27B. IL-12 modulates T cell and natural killer cell responses and induces interferon gamma production. Animal-Free IL-12 alpha Protein, Human (His) is the recombinant human-derived animal-FreeIL-12 alpha protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-12 alpha Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-12-alpha-protein-human-his.html

Purity

95.00

Smiles

MRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

Molecular Formula

3592 (Gene_ID) P29459 (R23-S219) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELK3 (ETS Domain-containing Protein Elk-3, ETS-related Protein ERP, ETS-related Protein NET, Serum Response Factor Accessory Protein 2, SAP-2, SRF Accessory Protein 2, NET, SAP2) APC
MBS6136412-01 0.1 mL

ELK3 (ETS Domain-containing Protein Elk-3, ETS-related Protein ERP, ETS-related Protein NET, Serum Response Factor Accessory Protein 2, SAP-2, SRF Accessory Protein 2, NET, SAP2) APC

Sign In for Pricing
View Details
ELK3 (ETS Domain-containing Protein Elk-3, ETS-related Protein ERP, ETS-related Protein NET, Serum Response Factor Accessory Protein 2, SAP-2, SRF Accessory Protein 2, NET, SAP2) APC
MBS6136412-02 5x 0.1 mL

ELK3 (ETS Domain-containing Protein Elk-3, ETS-related Protein ERP, ETS-related Protein NET, Serum Response Factor Accessory Protein 2, SAP-2, SRF Accessory Protein 2, NET, SAP2) APC

Sign In for Pricing
View Details
Lentiviral mouse Ppp4r2 shRNA (UAS) - Lentiviral mouse Ppp4r2 shRNA (UAS, RFP) (100)
GTR15190584 1 Vial

Lentiviral mouse Ppp4r2 shRNA (UAS) - Lentiviral mouse Ppp4r2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Bromodomain Containing Protein 8 (BRD8) Antibody (HRP)
abx334881-01 20 µg

Bromodomain Containing Protein 8 (BRD8) Antibody (HRP)

Sign In for Pricing
View Details
Bromodomain Containing Protein 8 (BRD8) Antibody (HRP)
abx334881-02 50 µg

Bromodomain Containing Protein 8 (BRD8) Antibody (HRP)

Sign In for Pricing
View Details
Bromodomain Containing Protein 8 (BRD8) Antibody (HRP)
abx334881-03 100 µg

Bromodomain Containing Protein 8 (BRD8) Antibody (HRP)

Sign In for Pricing
View Details