Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Naja sputatrix Cytotoxin 1

Product Specifications

Product Name Alternative

(Cardiotoxin-1) (CTX-1) (Ctx1)

Abbreviation

Recombinant Naja sputatrix Cytotoxin 1 protein

UniProt

O93471

Expression Region

22-81aa

Organism

Naja sputatrix (Malayan spitting cobra) (Naja naja sputatrix)

Target Sequence

LKCNKLVPLFYKTCPAGKNLCYKIFMVATPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Shows cytolytic activity on many different cells by forming pore in lipid membranes. In vivo, increases heart rate or kills the animal by cardiac arrest. In addition, it binds to heparin with high affinity, interacts with Kv channel-interacting protein 1 (KCNIP1) in a calcium-independent manner, and binds to integrin alpha-V/beta-3 (ITGAV/ITGB3) with moderate affinity.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.2 kDa

References & Citations

"Six isoforms of cardiotoxin in malayan spitting cobra (Naja naja sputatrix) venom: cloning and characterization of cDNAs." Jeyaseelan K., Armugam A., Lachumanan R., Tan C.H., Tan N.H. Biochim. Biophys. Acta 1380:209-222 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gastrin (GAST/2633), CF405S conjugate, 0.1mg/mL
BNC042633-100 1x 100 µL

Gastrin (GAST/2633), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3498), CF405S conjugate, 0.1mg/mL
BNC043498-100 1x 100 µL

PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3498), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Drebrin 1 (DBN1) (DBN1/3393), CF568 conjugate, 0.1mg/mL
BNC683393-500 1x 500 µL

Drebrin 1 (DBN1) (DBN1/3393), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ezrin / p81 (CPTC-Ezrin-1), CF488A conjugate, 0.1mg/mL
BNC882238-100 1x 100 µL

Ezrin / p81 (CPTC-Ezrin-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TCF4 (NM_001083962) Human Over-expression Lysate
LC421261 20 µg

TCF4 (NM_001083962) Human Over-expression Lysate

Sign In for Pricing
View Details
TMTC2 Human qPCR Primer Pair (NM_152588)
HP217823 200 Reactions

TMTC2 Human qPCR Primer Pair (NM_152588)

Sign In for Pricing
View Details