Recombinant Naja sputatrix Cytotoxin 1
Product Specifications
Product Name Alternative
(Cardiotoxin-1) (CTX-1) (Ctx1)
Abbreviation
Recombinant Naja sputatrix Cytotoxin 1 protein
UniProt
O93471
Expression Region
22-81aa
Organism
Naja sputatrix (Malayan spitting cobra) (Naja naja sputatrix)
Target Sequence
LKCNKLVPLFYKTCPAGKNLCYKIFMVATPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Type
In Stock Protein
Source
E.coli
Field of Research
Others
Relevance
Shows cytolytic activity on many different cells by forming pore in lipid membranes. In vivo, increases heart rate or kills the animal by cardiac arrest. In addition, it binds to heparin with high affinity, interacts with Kv channel-interacting protein 1 (KCNIP1) in a calcium-independent manner, and binds to integrin alpha-V/beta-3 (ITGAV/ITGB3) with moderate affinity.
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight
14.2 kDa
References & Citations
"Six isoforms of cardiotoxin in malayan spitting cobra (Naja naja sputatrix) venom: cloning and characterization of cDNAs." Jeyaseelan K., Armugam A., Lachumanan R., Tan C.H., Tan N.H. Biochim. Biophys. Acta 1380:209-222 (1998)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length of Mature Protein
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GP-2301-40 1 mL
Colloidal Gold Conjugated Arachis hypogaea Lectin (Peanut) -PNA-, 40nm
Sign In for Pricing
View Details 
PKSH031696 50 µg
Recombinant Human Coagulation Factor XI/F11 Protein (His Tag)
Sign In for Pricing
View Details 
BNC882395-500 1x 500 µL
CD25/ IL2RA (Activated Lymphocyte Marker) (IL2RA/2395), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![Elab Fluor® 647 Anti-Mouse Ly6A/E (Sca-1) Antibody[D7]](https://cdn.genprice.uk/products/763/68dd14ab061270361e7d2a34/imageurl/e-ab-f1191m.webp)
E-AB-F1191M-01 50 Tests
Elab Fluor® 647 Anti-Mouse Ly6A/E (Sca-1) Antibody[D7]
Sign In for Pricing
View Details E-AB-F1191M-02 100 Tests
Elab Fluor® 647 Anti-Mouse Ly6A/E (Sca-1) Antibody[D7]
Sign In for Pricing
View Details