Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-21, Rat

IL-21 Protein, crucial in immune responses and lymphocyte activation, exhibits biased expression in tissues like the thymus and spleen. Predicted to be active in the extracellular space, it serves as a biomarker for periodontal disease and is implicated in conditions like asthma, hepatocellular carcinoma, and systemic lupus erythematosus. IL-21 Protein, Rat is the recombinant rat-derived IL-21 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-21 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-21-protein-rat.html

Purity

98.0

Smiles

PDHLLIRLRHLMDIVEQLKIYENDLDPELLTAPQDVKGQCEHEAFACFQKAKLKPSNTGNNKTFINDLLAQLRRRLPAKRTGNKQRHMAKCPSCDLYEKKTPKEFLERLKWLLQKMIHQHLS

Molecular Formula

365769 (Gene_ID) A3QPB9/NP_001102413.1 (P25-S146) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTRNR2L3 Human Gene Knockout Kit (CRISPR)
KN430904 1 Kit

MTRNR2L3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
7-Keto-3a,12-a-dihydroxycholanic Acid
TRC-K188480-250MG 250 mg

7-Keto-3a,12-a-dihydroxycholanic Acid

Sign In for Pricing
View Details
Get3 Mouse Gene Knockout Kit (CRISPR)
KN501684 1 Kit

Get3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Sulfametrole
TRC-S699025-10MG 10 mg

Sulfametrole

Sign In for Pricing
View Details
4-Amino Levamisole Dihydrochloride
TRC-A611775-5MG 5 mg

4-Amino Levamisole Dihydrochloride

Sign In for Pricing
View Details
NANS Human Gene Knockout Kit (CRISPR)
KN400123 1 Kit

NANS Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details