Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-21, Rat

IL-21 Protein, crucial in immune responses and lymphocyte activation, exhibits biased expression in tissues like the thymus and spleen. Predicted to be active in the extracellular space, it serves as a biomarker for periodontal disease and is implicated in conditions like asthma, hepatocellular carcinoma, and systemic lupus erythematosus. IL-21 Protein, Rat is the recombinant rat-derived IL-21 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-21 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-21-protein-rat.html

Purity

98.0

Smiles

PDHLLIRLRHLMDIVEQLKIYENDLDPELLTAPQDVKGQCEHEAFACFQKAKLKPSNTGNNKTFINDLLAQLRRRLPAKRTGNKQRHMAKCPSCDLYEKKTPKEFLERLKWLLQKMIHQHLS

Molecular Formula

365769 (Gene_ID) A3QPB9/NP_001102413.1 (P25-S146) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

((HYNIC)-D-alanyl)-L-proline-boronic Acid TFA Salt
TRC-H972225-5MG 5 mg

((HYNIC)-D-alanyl)-L-proline-boronic Acid TFA Salt

Sign In for Pricing
View Details
UBL7 (NM_201265) Human Recombinant Protein
TP314894L 1 mg

UBL7 (NM_201265) Human Recombinant Protein

Sign In for Pricing
View Details
(2-Chloroethyl)(3-chloropropyl)amine Hydrochloride
TRC-C364930-1G 1 g

(2-Chloroethyl)(3-chloropropyl)amine Hydrochloride

Sign In for Pricing
View Details
Tex22 Mouse Gene Knockout Kit (CRISPR)
KN517438 1 Kit

Tex22 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TNPO3 Human Gene Knockout Kit (CRISPR)
KN423103 1 Kit

TNPO3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS632763 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details