IL-21, Rat
IL-21 Protein, crucial in immune responses and lymphocyte activation, exhibits biased expression in tissues like the thymus and spleen. Predicted to be active in the extracellular space, it serves as a biomarker for periodontal disease and is implicated in conditions like asthma, hepatocellular carcinoma, and systemic lupus erythematosus. IL-21 Protein, Rat is the recombinant rat-derived IL-21 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
IL-21 Protein, Rat, Rat, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-21-protein-rat.html
Purity
98.0
Smiles
PDHLLIRLRHLMDIVEQLKIYENDLDPELLTAPQDVKGQCEHEAFACFQKAKLKPSNTGNNKTFINDLLAQLRRRLPAKRTGNKQRHMAKCPSCDLYEKKTPKEFLERLKWLLQKMIHQHLS
Molecular Formula
365769 (Gene_ID) A3QPB9/NP_001102413.1 (P25-S146) (Accession)
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
RHOH (Rho-related GTP-binding Protein RhoH, GTP-binding Protein TTF, Translocation Three Four Protein, ARHH, TTF) (HRP)
RHOH (Rho-related GTP-binding Protein RhoH, GTP-binding Protein TTF, Translocation Three Four Protein, ARHH, TTF) (HRP)
