Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-21, Rat

IL-21 Protein, crucial in immune responses and lymphocyte activation, exhibits biased expression in tissues like the thymus and spleen. Predicted to be active in the extracellular space, it serves as a biomarker for periodontal disease and is implicated in conditions like asthma, hepatocellular carcinoma, and systemic lupus erythematosus. IL-21 Protein, Rat is the recombinant rat-derived IL-21 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-21 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-21-protein-rat.html

Purity

98.0

Smiles

PDHLLIRLRHLMDIVEQLKIYENDLDPELLTAPQDVKGQCEHEAFACFQKAKLKPSNTGNNKTFINDLLAQLRRRLPAKRTGNKQRHMAKCPSCDLYEKKTPKEFLERLKWLLQKMIHQHLS

Molecular Formula

365769 (Gene_ID) A3QPB9/NP_001102413.1 (P25-S146) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIB1 Antibody
A49707-50UG 50 µg

MIB1 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal CDK8 Antibody
NBP3-29273 25 µg

Rabbit Polyclonal CDK8 Antibody

Sign In for Pricing
View Details
Human GABRG2 Pre-designed siRNA Set B
SI006003B 1 Each

Human GABRG2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
CNDP2 CytoSection
TS429984P5 25 Slides

CNDP2 CytoSection

Sign In for Pricing
View Details
ABCA5 Lentiviral Vector (mouse) (pLenti-GIII-CMV )
11020064 1.0 µg DNA

ABCA5 Lentiviral Vector (mouse) (pLenti-GIII-CMV )

Sign In for Pricing
View Details
Dnajc22 Double Nickase Plasmid (m2)
sc-428438-NIC-2 20 µg

Dnajc22 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details