Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free FGF-9, Human (His)

The FGF-9 protein plays a key role in embryonic development, controlling cell proliferation, differentiation, and migration. Its diverse functions include glial cell growth and differentiation, gliosis in brain repair, neuronal cell differentiation and survival, and promotion of glioma growth. Animal-Free FGF-9 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-9 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free FGF-9 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-fgf-9-protein-human-his.html

Purity

95.0

Smiles

MPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Molecular Formula

2254 (Gene_ID) P31371 (M1-S208) (Accession)

Molecular Weight

Approximately 24 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Saccharomyces cerevisiae 3-ketoacyl-CoA reductase (SCY_0371), partial
MBS7064943 Inquire

Recombinant Saccharomyces cerevisiae 3-ketoacyl-CoA reductase (SCY_0371), partial

Sign In for Pricing
View Details
RFX2 sgRNA CRISPR Lentivector (Human) (Target 3)
K1813604 1.0 µg DNA

RFX2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
ZAP-70 (3D2A4) : m-IgGκ BP-HRP Bundle
sc-534194 1 Kit

ZAP-70 (3D2A4) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
GC Rabbit pAb
MBS8545740-01 0.1 mL

GC Rabbit pAb

Sign In for Pricing
View Details
GC Rabbit pAb
MBS8545740-02 0.1 mL (AF405L)

GC Rabbit pAb

Sign In for Pricing
View Details
GC Rabbit pAb
MBS8545740-03 0.1 mL (AF405S)

GC Rabbit pAb

Sign In for Pricing
View Details