Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mesocricetus auratus Interferon gamma (IFNG)

Product Specifications

Product Name Alternative

(IFN-gamma)

Abbreviation

Recombinant Mesocricetus auratus IFNG protein

Gene Name

IFNG

UniProt

O35497

Expression Region

24-174aa

Organism

Mesocricetus auratus (Golden hamster)

Target Sequence

QGTLIEEIENLKKYFNSSSLDVVNGGDLVFNILTNWQKAGDTKIIESQIVSFYFKLFEALKDNQAIQRSIDTIKADLFANFFNSSMEKLNDFVKLTKIPVNDLQVQRKAVNELISVMPHLSRKLSLRKRKRSRCCFGGGNRPNKNILASNI

Tag

N-terminal 6xHis-tagged and C-terminal Strep II-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Type II interferon produced by immune cells such as T-cells and NK cells that plays crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation. Primarily signals through the JAK-STAT pathway after interaction with its receptor IFNGR1 to affect gene regulation. Upon IFNG binding, IFNGR1 intracellular domain opens out to allow association of downstream signaling components JAK2, JAK1 and STAT1, leading to STAT1 activation, nuclear translocation and transcription of IFNG-regulated genes. Many of the induced genes are transcription factors such as IRF1 that are able to further drive regulation of a next wave of transcription. Plays a role in class I antigen presentation pathway by inducing a replacement of catalytic proteasome subunits with immunoproteasome subunits. In turn, increases the quantity, quality, and repertoire of peptides for class I MHC loading. Increases the efficiency of peptide generation also by inducing the expression of activator PA28 that associates with the proteasome and alters its proteolytic cleavage preference. Up-regulates as well MHC II complexes on the cell surface by promoting expression of several key molecules such as cathepsins B/CTSB, H/CTSH, and L/CTSL. Participates in the regulation of hematopoietic stem cells during development and under homeostatic conditions by affecting their development, quiescence, and differentiation.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.3 kDa

References & Citations

"Cloning of Syrian hamster (Mesocricetus auratus) cytokine cDNAs and analysis of cytokine mRNA expression in experimental visceral leishmaniasis." Melby P.C., Tryon V.V., Chandrasekar B., Freeman G.L. Infect. Immun. 66:2135-2142 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SNX15 (Sorting Nexin-15, HSAF001435) (Biotin)
MBS6144511-01 0.1 mL

SNX15 (Sorting Nexin-15, HSAF001435) (Biotin)

Ask
View Details
SNX15 (Sorting Nexin-15, HSAF001435) (Biotin)
MBS6144511-02 5x 0.1 mL

SNX15 (Sorting Nexin-15, HSAF001435) (Biotin)

Ask
View Details
F(ab')2 Goat IgG (H&L) Antibody Texas Red™ Conjugated Pre-Adsorbed
TA398140 500 µL

F(ab')2 Goat IgG (H&L) Antibody Texas Red™ Conjugated Pre-Adsorbed

Ask
View Details
Anti-EBV-LMP1, EBS-I-025, mouse mab
691637 1 mL (100 µg/mL)

Anti-EBV-LMP1, EBS-I-025, mouse mab

Ask
View Details
Recombinant Human ATP5ME Protein, N-His-SUMO
YHF17001 100 μg

Recombinant Human ATP5ME Protein, N-His-SUMO

Ask
View Details
CD8a discontinued
516490-01 50 µg

CD8a discontinued

Ask
View Details