Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAMDEC1, Human (HEK293, His)

ADAMDEC1 Protein, Human (HEK293, His) is human recombinant ADAM-like protein decysin-1 (ADAMDEC1) with a 6His tag at the C-terminus.ADAMDEC1 Protein, Human (HEK293, His) is produced by mammalian expression system in human cells.

Product Specifications

Product Name Alternative

ADAMDEC1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/adamdec1-protein-human-hek293-his.html

Purity

95.57

Smiles

KSPEKEDFLRAQKYIDLYLVLDNAFYKNYNENLTLIRSFVFDVMNLLNVIYNTIDVQVALVGMEIWSDGDKIKVVPSASTTFDNFLRWHSSNLGKKIHDHAQLLSGISFNNRRVGLAASNSLCSPSSVAVIEAKKKNNVALVGVMSHELGHVLGMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE

Molecular Formula

27299 (Gene_ID) O15204 (K206-E470) (Accession)

Molecular Weight

Approximately 38.0 kDa

References & Citations

[1]Yako Y, et al. ADAM-like Decysin-1 (ADAMDEC1) is a positive regulator of Epithelial Defense Against Cancer (EDAC) that promotes apical extrusion of RasV12-transformed cells. Sci Rep. 2018 Jun 25;8 (1) :9639.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

THEM4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2369306 1.0 µg DNA

THEM4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Recombinant Rhesus Macaque SNRPG Protein, His (Fc)-Avi-tagged
SNRPG-4199R 50 µg

Recombinant Rhesus Macaque SNRPG Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
SOAT2 Protein Vector (Rat) (pPM-C-His)
PV307245 500 ng

SOAT2 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Lentiviral mouse Abcb5 shRNA (UAS) - Lentiviral mouse Abcb5 shRNA (UAS, GFP) plasmid
GTR15192442 1 Vial

Lentiviral mouse Abcb5 shRNA (UAS) - Lentiviral mouse Abcb5 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
RABGAP1L Human Pre-designed siRNA Set A
HY-RS11585 1 Set

RABGAP1L Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
RanGAP 1-PE
MBS6258889-01 0.1 mL

RanGAP 1-PE

Sign In for Pricing
View Details