Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAMDEC1, Human (HEK293, His)

ADAMDEC1 Protein, Human (HEK293, His) is human recombinant ADAM-like protein decysin-1 (ADAMDEC1) with a 6His tag at the C-terminus.ADAMDEC1 Protein, Human (HEK293, His) is produced by mammalian expression system in human cells.

Product Specifications

Product Name Alternative

ADAMDEC1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/adamdec1-protein-human-hek293-his.html

Purity

95.57

Smiles

KSPEKEDFLRAQKYIDLYLVLDNAFYKNYNENLTLIRSFVFDVMNLLNVIYNTIDVQVALVGMEIWSDGDKIKVVPSASTTFDNFLRWHSSNLGKKIHDHAQLLSGISFNNRRVGLAASNSLCSPSSVAVIEAKKKNNVALVGVMSHELGHVLGMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE

Molecular Formula

27299 (Gene_ID) O15204 (K206-E470) (Accession)

Molecular Weight

Approximately 38.0 kDa

References & Citations

[1]Yako Y, et al. ADAM-like Decysin-1 (ADAMDEC1) is a positive regulator of Epithelial Defense Against Cancer (EDAC) that promotes apical extrusion of RasV12-transformed cells. Sci Rep. 2018 Jun 25;8 (1) :9639.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEMP1 (NM_001048212) Human Tagged ORF Clone
RC215622 10 µg

CEMP1 (NM_001048212) Human Tagged ORF Clone

Sign In for Pricing
View Details
Sympk-set siRNA/shRNA/RNAi Lentivector (Rat)
45958096 4x 500 ng

Sympk-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
NOL5A (NOP56)
470086 50 µg

NOL5A (NOP56)

Sign In for Pricing
View Details
Pdcd-7 CRISPR/Cas9 KO Plasmid (h)
sc-411411 20 µg

Pdcd-7 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
IP10 (CXCL10) (NM_001565) Human Tagged ORF Clone Lentiviral Particle
RC203141L4V 200 µL

IP10 (CXCL10) (NM_001565) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-CDK19 Antibody
CTA1426-01 30 µL

Anti-CDK19 Antibody

Sign In for Pricing
View Details