Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAMDEC1, Human (HEK293, His)

ADAMDEC1 Protein, Human (HEK293, His) is human recombinant ADAM-like protein decysin-1 (ADAMDEC1) with a 6His tag at the C-terminus.ADAMDEC1 Protein, Human (HEK293, His) is produced by mammalian expression system in human cells.

Product Specifications

Product Name Alternative

ADAMDEC1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/adamdec1-protein-human-hek293-his.html

Purity

95.57

Smiles

KSPEKEDFLRAQKYIDLYLVLDNAFYKNYNENLTLIRSFVFDVMNLLNVIYNTIDVQVALVGMEIWSDGDKIKVVPSASTTFDNFLRWHSSNLGKKIHDHAQLLSGISFNNRRVGLAASNSLCSPSSVAVIEAKKKNNVALVGVMSHELGHVLGMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE

Molecular Formula

27299 (Gene_ID) O15204 (K206-E470) (Accession)

Molecular Weight

Approximately 38.0 kDa

References & Citations

[1]Yako Y, et al. ADAM-like Decysin-1 (ADAMDEC1) is a positive regulator of Epithelial Defense Against Cancer (EDAC) that promotes apical extrusion of RasV12-transformed cells. Sci Rep. 2018 Jun 25;8 (1) :9639.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNX29 (E-3) Alexa Fluor® 790
sc-514318 AF790 200 µg/mL

SNX29 (E-3) Alexa Fluor® 790

Sign In for Pricing
View Details
CTGF siRNA (Rat)
CRR1793-01 15 nmol

CTGF siRNA (Rat)

Sign In for Pricing
View Details
CTGF siRNA (Rat)
CRR1793-02 30 nmol

CTGF siRNA (Rat)

Sign In for Pricing
View Details
EN1 Rabbit Polyclonal Antibody
E10G13321 100 µL

EN1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NP60 Double Nickase Plasmid (m)
sc-428689-NIC 20 µg

NP60 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Anti-TAGLN2 antibody
STJ28844 100 µl

Anti-TAGLN2 antibody

Sign In for Pricing
View Details