Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAMDEC1, Human (HEK293, His)

ADAMDEC1 Protein, Human (HEK293, His) is human recombinant ADAM-like protein decysin-1 (ADAMDEC1) with a 6His tag at the C-terminus.ADAMDEC1 Protein, Human (HEK293, His) is produced by mammalian expression system in human cells.

Product Specifications

Product Name Alternative

ADAMDEC1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/adamdec1-protein-human-hek293-his.html

Purity

95.57

Smiles

KSPEKEDFLRAQKYIDLYLVLDNAFYKNYNENLTLIRSFVFDVMNLLNVIYNTIDVQVALVGMEIWSDGDKIKVVPSASTTFDNFLRWHSSNLGKKIHDHAQLLSGISFNNRRVGLAASNSLCSPSSVAVIEAKKKNNVALVGVMSHELGHVLGMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE

Molecular Formula

27299 (Gene_ID) O15204 (K206-E470) (Accession)

Molecular Weight

Approximately 38.0 kDa

References & Citations

[1]Yako Y, et al. ADAM-like Decysin-1 (ADAMDEC1) is a positive regulator of Epithelial Defense Against Cancer (EDAC) that promotes apical extrusion of RasV12-transformed cells. Sci Rep. 2018 Jun 25;8 (1) :9639.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

STK32A (NM_145001) Human Mass Spec Standard
PH304769 10 µg

STK32A (NM_145001) Human Mass Spec Standard

Sign In for Pricing
View Details
OGT (NM_181673) Human Untagged Clone
SC109934 10 µg

OGT (NM_181673) Human Untagged Clone

Sign In for Pricing
View Details
N-Dodecanoylglycine-d23
TRC-D494643-10MG 10 mg

N-Dodecanoylglycine-d23

Sign In for Pricing
View Details
Mouse streptococcus pneumophila antigen ELISA kit
ELA-E2046m 96 Tests

Mouse streptococcus pneumophila antigen ELISA kit

Sign In for Pricing
View Details
anti-Dishevelled 3
YF-PA11457 50 ul

anti-Dishevelled 3

Sign In for Pricing
View Details
Lentiviral mouse Foxe1 shRNA (UAS) - Lentiviral mouse Foxe1 shRNA (UAS, RFP) plasmid
GTR15110641 1 Vial

Lentiviral mouse Foxe1 shRNA (UAS) - Lentiviral mouse Foxe1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details