Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAMDEC1, Human (HEK293, His)

ADAMDEC1 Protein, Human (HEK293, His) is human recombinant ADAM-like protein decysin-1 (ADAMDEC1) with a 6His tag at the C-terminus.ADAMDEC1 Protein, Human (HEK293, His) is produced by mammalian expression system in human cells.

Product Specifications

Product Name Alternative

ADAMDEC1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/adamdec1-protein-human-hek293-his.html

Purity

95.57

Smiles

KSPEKEDFLRAQKYIDLYLVLDNAFYKNYNENLTLIRSFVFDVMNLLNVIYNTIDVQVALVGMEIWSDGDKIKVVPSASTTFDNFLRWHSSNLGKKIHDHAQLLSGISFNNRRVGLAASNSLCSPSSVAVIEAKKKNNVALVGVMSHELGHVLGMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE

Molecular Formula

27299 (Gene_ID) O15204 (K206-E470) (Accession)

Molecular Weight

Approximately 38.0 kDa

References & Citations

[1]Yako Y, et al. ADAM-like Decysin-1 (ADAMDEC1) is a positive regulator of Epithelial Defense Against Cancer (EDAC) that promotes apical extrusion of RasV12-transformed cells. Sci Rep. 2018 Jun 25;8 (1) :9639.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Fam205c (NM_177785) AAV Particle
MR205703A1V 250 µL

Mouse Fam205c (NM_177785) AAV Particle

Sign In for Pricing
View Details
1600027N09Rik 3'UTR Luciferase Stable Cell Line
TU100113 1.0 mL

1600027N09Rik 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Anti Puccinia Sorghi Cullin4 Like Pab
272583 100 µg

Anti Puccinia Sorghi Cullin4 Like Pab

Sign In for Pricing
View Details
Polyethylene Glycol 20000 Flakes (PEG 20000) ExiPlus, Multi-Compendial
33817-01 100 g

Polyethylene Glycol 20000 Flakes (PEG 20000) ExiPlus, Multi-Compendial

Sign In for Pricing
View Details
Polyethylene Glycol 20000 Flakes (PEG 20000) ExiPlus, Multi-Compendial
33817-02 500 g

Polyethylene Glycol 20000 Flakes (PEG 20000) ExiPlus, Multi-Compendial

Sign In for Pricing
View Details
Polyethylene Glycol 20000 Flakes (PEG 20000) ExiPlus, Multi-Compendial
33817-03 1 Kg

Polyethylene Glycol 20000 Flakes (PEG 20000) ExiPlus, Multi-Compendial

Sign In for Pricing
View Details