Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAMDEC1, Human (HEK293, His)

ADAMDEC1 Protein, Human (HEK293, His) is human recombinant ADAM-like protein decysin-1 (ADAMDEC1) with a 6His tag at the C-terminus.ADAMDEC1 Protein, Human (HEK293, His) is produced by mammalian expression system in human cells.

Product Specifications

Product Name Alternative

ADAMDEC1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/adamdec1-protein-human-hek293-his.html

Purity

95.57

Smiles

KSPEKEDFLRAQKYIDLYLVLDNAFYKNYNENLTLIRSFVFDVMNLLNVIYNTIDVQVALVGMEIWSDGDKIKVVPSASTTFDNFLRWHSSNLGKKIHDHAQLLSGISFNNRRVGLAASNSLCSPSSVAVIEAKKKNNVALVGVMSHELGHVLGMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE

Molecular Formula

27299 (Gene_ID) O15204 (K206-E470) (Accession)

Molecular Weight

Approximately 38.0 kDa

References & Citations

[1]Yako Y, et al. ADAM-like Decysin-1 (ADAMDEC1) is a positive regulator of Epithelial Defense Against Cancer (EDAC) that promotes apical extrusion of RasV12-transformed cells. Sci Rep. 2018 Jun 25;8 (1) :9639.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Naptumomab Biosimilar - Research Grade
ICH5007-20mg 20 mg

Naptumomab Biosimilar - Research Grade

Sign In for Pricing
View Details
Temuterkib (LY3214996) 500mg
A16843-500 500 mg

Temuterkib (LY3214996) 500mg

Sign In for Pricing
View Details
PCIA1, ID (DDA1, C19orf58, PCIA1, DET1- and DDB1-associated protein 1, Placenta cross-immune reaction antigen 1) (MaxLight 405) discontinued
039764-ML405 100 µL

PCIA1, ID (DDA1, C19orf58, PCIA1, DET1- and DDB1-associated protein 1, Placenta cross-immune reaction antigen 1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Recombinant Human CAMK2beta (N-GST tag)
Z500055 10 µg

Recombinant Human CAMK2beta (N-GST tag)

Sign In for Pricing
View Details
Human Guanylate nucleotide binding protein 4 ELISA Kit
MBS729971-01 48 Well

Human Guanylate nucleotide binding protein 4 ELISA Kit

Sign In for Pricing
View Details
Human Guanylate nucleotide binding protein 4 ELISA Kit
MBS729971-02 96 Well

Human Guanylate nucleotide binding protein 4 ELISA Kit

Sign In for Pricing
View Details