Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAMDEC1, Human (HEK293, His)

ADAMDEC1 Protein, Human (HEK293, His) is human recombinant ADAM-like protein decysin-1 (ADAMDEC1) with a 6His tag at the C-terminus.ADAMDEC1 Protein, Human (HEK293, His) is produced by mammalian expression system in human cells.

Product Specifications

Product Name Alternative

ADAMDEC1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/adamdec1-protein-human-hek293-his.html

Purity

95.57

Smiles

KSPEKEDFLRAQKYIDLYLVLDNAFYKNYNENLTLIRSFVFDVMNLLNVIYNTIDVQVALVGMEIWSDGDKIKVVPSASTTFDNFLRWHSSNLGKKIHDHAQLLSGISFNNRRVGLAASNSLCSPSSVAVIEAKKKNNVALVGVMSHELGHVLGMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE

Molecular Formula

27299 (Gene_ID) O15204 (K206-E470) (Accession)

Molecular Weight

Approximately 38.0 kDa

References & Citations

[1]Yako Y, et al. ADAM-like Decysin-1 (ADAMDEC1) is a positive regulator of Epithelial Defense Against Cancer (EDAC) that promotes apical extrusion of RasV12-transformed cells. Sci Rep. 2018 Jun 25;8 (1) :9639.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PRMT5 sgRNA gene knockout kit - Lentiviral human PRMT5 sgRNA gene knockout kit (25)
GTR15375654 1 Vial

Lentiviral human PRMT5 sgRNA gene knockout kit - Lentiviral human PRMT5 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Human OR4K17 siRNA
abx927174-01 15 nmol

Human OR4K17 siRNA

Sign In for Pricing
View Details
Human OR4K17 siRNA
abx927174-02 30 nmol

Human OR4K17 siRNA

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Affinity Purified anti-Dog IgG [H&L] [Goat]
MBS417825-01 0.25 mg

Alkaline Phosphatase Conjugated Affinity Purified anti-Dog IgG [H&L] [Goat]

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Affinity Purified anti-Dog IgG [H&L] [Goat]
MBS417825-02 5x 0.25 mg

Alkaline Phosphatase Conjugated Affinity Purified anti-Dog IgG [H&L] [Goat]

Sign In for Pricing
View Details
GFAP antibody
10R-4206 100 ul

GFAP antibody

Sign In for Pricing
View Details