Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

2B4/CD244, Human (HEK293, His)

2B4/CD244 protein exhibits heightened affinity for binding to CD48, surpassing isoform 1, leading to increased cytotoxicity and intracellular calcium release. The stronger interaction implies more robust engagement, potentially amplifying cellular responses, particularly heightened cytotoxic activity and intracellular calcium release. 2B4/CD244 Protein, Human (HEK293, His) is the recombinant human-derived 2B4/CD244 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

2B4/CD244 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/2b4-cd244-protein-human-hek-293-his.html

Smiles

CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFR

Molecular Formula

51744 (Gene_ID) Q9BZW8-2 (C22-R221) (Accession)

Molecular Weight

Approximately 35-60 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1387), CF568 conjugate, 0.1mg/mL
BNC681387-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1387), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL
BNC740040-500 1x 500 µL

CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2552), CF405S conjugate, 0.1mg/mL
BNC042552-500 1x 500 µL

AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2552), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), 1mg/mL
BNUM0276-50 1x 50 µL

TAG-72 / CA72.4 (B72.3), 1mg/mL

Sign In for Pricing
View Details
Human Lambda Light Chain (LcN-2), CF568 conjugate, 0.1mg/mL
BNC680631-100 1x 100 µL

Human Lambda Light Chain (LcN-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FSH beta (FSHb/1062), CF405S conjugate, 0.1mg/mL
BNC041062-500 1x 500 µL

FSH beta (FSHb/1062), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details