Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SECTM1A, Mouse (HEK293, His)

SECTM1A Protein is a protein that encoded by SECTM1A gene. SECTM1A can bind to GITR on the surface of macrophages and activate the PI3K–Akt pathway, thereby enhancing the phagocytosis and bactericidal ability of macrophages SECTM1A can inhibit NF-κB signaling by activating the LXRα pathway, therby suppressing the inflammatory response. SECTM1A can positively regulate local proliferation of TRMs in the context of acute inflammation. SECTM1A Protein, Mouse (HEK293, His) is the recombinant mouse-derived SECTM1A protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SECTM1A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sectm1a-protein-mouse-hek-293-his.html

Purity

96

Smiles

QNKSWDNPICTEGILSVPRGNPAVMTCNISNTFTDVTIQLSANGKDKTIFDKKPQGNFSWRGWELQVQGGLAQLVIKDTQDDHTGIYLWQLHGRQRCYKNITLNILEPSNEDKVPDTTLFTSFPDHAKSSPIEGKPGT

Molecular Formula

209588 (Gene_ID) A2ABP9 (Q28­T165) (Accession)

Molecular Weight

Approximately 20-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL
BNC740029-100 1x 100 µL

Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF568 conjugate, 0.1mg/mL
BNC680177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF640R conjugate, 0.1mg/mL
BNC400149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF740 conjugate, 0.1mg/mL
BNC741045-500 1x 500 µL

CD16 (C16/1045), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF594 conjugate, 0.1mg/mL
BNC940851-100 1x 100 µL

HSP60 (LK1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL
BNC471820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details