Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WBP2, Human (His)

WBP2 Protein, Human (His) is the recombinant human-derived WBP2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

WBP2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/wbp2-protein-human-his.html

Smiles

MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEA

Molecular Formula

23558 (Gene_ID) Q969T9-1 (M1-A100) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Automatic Distillation Tester BPTL-249
BPTL-249 1 Unit

Automatic Distillation Tester BPTL-249

Sign In for Pricing
View Details
NME1 / nm23-H1 / NDPK-A (Suppressor of Metastasis) (CPTC-NME1-2), CF488A conjugate, 0.1mg/mL
BNC882247-500 1x 500 µL

NME1 / nm23-H1 / NDPK-A (Suppressor of Metastasis) (CPTC-NME1-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P3H3 Polyclonal Antibody
E-AB-11362-01 20 µL

P3H3 Polyclonal Antibody

Sign In for Pricing
View Details
P3H3 Polyclonal Antibody
E-AB-11362-02 60 µL

P3H3 Polyclonal Antibody

Sign In for Pricing
View Details
P3H3 Polyclonal Antibody
E-AB-11362-03 120 µL

P3H3 Polyclonal Antibody

Sign In for Pricing
View Details
P3H3 Polyclonal Antibody
E-AB-11362-04 200 µL

P3H3 Polyclonal Antibody

Sign In for Pricing
View Details