Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WBP2, Human (His)

WBP2 Protein, Human (His) is the recombinant human-derived WBP2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

WBP2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/wbp2-protein-human-his.html

Smiles

MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEA

Molecular Formula

23558 (Gene_ID) Q969T9-1 (M1-A100) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Urolithin C
TRC-U847015-25MG 25 mg

Urolithin C

Sign In for Pricing
View Details
Recombinant Human CD155/PVR/NECL5 Protein (His Tag)
PKSH033563-01 10 µg

Recombinant Human CD155/PVR/NECL5 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CD155/PVR/NECL5 Protein (His Tag)
PKSH033563-02 50 µg

Recombinant Human CD155/PVR/NECL5 Protein (His Tag)

Sign In for Pricing
View Details
XFD430 C5 maleimide
70022-AAT 1 mg

XFD430 C5 maleimide

Sign In for Pricing
View Details
Human PPAN-P2RY11 activation kit by CRISPRa
GA118880 1 Kit

Human PPAN-P2RY11 activation kit by CRISPRa

Sign In for Pricing
View Details
KIR3DL1 Rabbit Monoclonal Antibody [Clone ID: OTIR1A9]
TA594056S 30 µL

KIR3DL1 Rabbit Monoclonal Antibody [Clone ID: OTIR1A9]

Sign In for Pricing
View Details