Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAA4, Human (His)

SAA4 Protein, a notable acute phase reactant, plays a pivotal role in responding to physiological challenges. As a crucial apolipoprotein within the HDL complex, SAA4 regulates lipid metabolism and is integral to high-density lipoprotein dynamics. Elevated during acute phase responses, SAA4 underscores its significance in the adaptive mechanisms to diverse stressors. SAA4 Protein, Human (His) is the recombinant human-derived SAA4 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SAA4 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/saa4-protein-human-his.html

Purity

95

Smiles

ESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDCYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY

Molecular Formula

6291 (Gene_ID) P35542 (E19-Y130) (Accession)

Molecular Weight

Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

α, ω-Bis-Formylpentanamido PEG
1120000-6.1G 1 g

α, ω-Bis-Formylpentanamido PEG

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS631656 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
N-Boc-L-Allylglycine
TRC-B600500-250MG 250 mg

N-Boc-L-Allylglycine

Sign In for Pricing
View Details
P21WAF1 (Tumor Suppressor Protein) (AC8), CF488A conjugate, 0.1mg/mL
BNC882378-100 1x 100 µL

P21WAF1 (Tumor Suppressor Protein) (AC8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse PDGFRa/CD140a Protein (Fc Tag)
PKSM041120-01 10 µg

Recombinant Mouse PDGFRa/CD140a Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse PDGFRa/CD140a Protein (Fc Tag)
PKSM041120-02 50 µg

Recombinant Mouse PDGFRa/CD140a Protein (Fc Tag)

Sign In for Pricing
View Details