Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAA4, Human (His)

SAA4 Protein, a notable acute phase reactant, plays a pivotal role in responding to physiological challenges. As a crucial apolipoprotein within the HDL complex, SAA4 regulates lipid metabolism and is integral to high-density lipoprotein dynamics. Elevated during acute phase responses, SAA4 underscores its significance in the adaptive mechanisms to diverse stressors. SAA4 Protein, Human (His) is the recombinant human-derived SAA4 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SAA4 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/saa4-protein-human-his.html

Purity

95

Smiles

ESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDCYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY

Molecular Formula

6291 (Gene_ID) P35542 (E19-Y130) (Accession)

Molecular Weight

Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Morroniside
TRC-M725700-10MG 10 mg

Morroniside

Sign In for Pricing
View Details
Mouse Ndufa7 activation kit by CRISPRa
GA206767 1 Kit

Mouse Ndufa7 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant DLX4 Antibody
RC-4684-01 50 μL

Recombinant DLX4 Antibody

Sign In for Pricing
View Details
Recombinant DLX4 Antibody
RC-4684-02 100 µL

Recombinant DLX4 Antibody

Sign In for Pricing
View Details
Recombinant DLX4 Antibody
RC-4684-03 1 mL

Recombinant DLX4 Antibody

Sign In for Pricing
View Details
Recombinant Human SNAP25 protein (His tag)
PDEH100980-01 20 µg

Recombinant Human SNAP25 protein (His tag)

Sign In for Pricing
View Details