Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAA4, Human (His)

SAA4 Protein, a notable acute phase reactant, plays a pivotal role in responding to physiological challenges. As a crucial apolipoprotein within the HDL complex, SAA4 regulates lipid metabolism and is integral to high-density lipoprotein dynamics. Elevated during acute phase responses, SAA4 underscores its significance in the adaptive mechanisms to diverse stressors. SAA4 Protein, Human (His) is the recombinant human-derived SAA4 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SAA4 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/saa4-protein-human-his.html

Purity

95

Smiles

ESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDCYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY

Molecular Formula

6291 (Gene_ID) P35542 (E19-Y130) (Accession)

Molecular Weight

Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Progesterone (6-5E-3F), CF405S conjugate, 0.1mg/mL
BNC040236-500 1x 500 µL

Progesterone (6-5E-3F), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CHRNA6 Rabbit Polyclonal Antibody
TA367512 100 µL

CHRNA6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse IL-33 (Interleukin 33) ELISA Kit
E-EL-M2642-01 24 Tests

Mouse IL-33 (Interleukin 33) ELISA Kit

Sign In for Pricing
View Details
Mouse IL-33 (Interleukin 33) ELISA Kit
E-EL-M2642-02 48 Tests

Mouse IL-33 (Interleukin 33) ELISA Kit

Sign In for Pricing
View Details
Mouse IL-33 (Interleukin 33) ELISA Kit
E-EL-M2642-03 96 Tests

Mouse IL-33 (Interleukin 33) ELISA Kit

Sign In for Pricing
View Details
Bis(2-butoxyethyl) Phthalate-d4
TRC-B415117-10MG 10 mg

Bis(2-butoxyethyl) Phthalate-d4

Sign In for Pricing
View Details