Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Mouse

IL-1 beta is a potent proinflammatory cytokine expressed by monocytes, macrophages, and dendritic cells. IL-1 beta plays a key role in inflammation and immunologic reactions[1][2]. IL-1 beta Protein, Mouse consists of 152 amino acids (V118-S269) and is expressed in E. coli.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-mouse.html

Purity

98.00

Smiles

VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

Molecular Formula

16176 (Gene_ID) P10749 (V118-S269) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Jan Petrasek, et al. IL-1 receptor antagonist ameliorates inflammasome-dependent alcoholic steatohepatitis in mice. J Clin Invest. 2012 Oct;122 (10) :3476-89.|[2]Karina Zitta, et al. Interleukin-1beta regulates cell proliferation and activity of extracellular matrix remodelling enzymes in cultured primary pig heart cells. Biochem Biophys Res Commun. 2010 Sep 3;399 (4) :542-7.|[3]Kenichi Shimada, et al. Caspase-1 dependent IL-1β secretion is critical for host defense in a mouse model of Chlamydia pneumoniae lung infection. PLoS One. 2011;6 (6) :e21477.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Catenin, beta (CTNNB1) (CTNNB1/2030R), 0.2mg/mL
BNUB2030-100 1x 100 µL

Catenin, beta (CTNNB1) (CTNNB1/2030R), 0.2mg/mL

Sign In for Pricing
View Details
TPD52L3 Polyclonal Antibody
E-AB-65358-01 60 µL

TPD52L3 Polyclonal Antibody

Sign In for Pricing
View Details
TPD52L3 Polyclonal Antibody
E-AB-65358-02 120 µL

TPD52L3 Polyclonal Antibody

Sign In for Pricing
View Details
TPD52L3 Polyclonal Antibody
E-AB-65358-03 200 µL

TPD52L3 Polyclonal Antibody

Sign In for Pricing
View Details
CD6 (3F7B5), CF740 conjugate, 0.1mg/mL
BNC740428-500 1x 500 µL

CD6 (3F7B5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FLT4 Polyclonal Antibody
E-AB-66045-01 60 µL

FLT4 Polyclonal Antibody

Sign In for Pricing
View Details