Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proton-coupled zinc antiporter SLC30A8 (SLC30A8), partial

Product Specifications

Product Name Alternative

Solute carrier family 30 member 8 (ZNT8)

Abbreviation

Recombinant Human SLC30A8 protein, partial

Gene Name

SLC30A8

UniProt

Q8IWU4

Expression Region

267-369aa

Organism

Homo sapiens (Human)

Target Sequence

LKDFSILLMEGVPKSLNYSGVKELILAVDGVLSVHSLHIWSLTMNQVILSAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQMESPVDQDPDCLFCEDPCD

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Facilitates the accumulation of zinc from the cytoplasm into intracellular vesicles, being a zinc-efflux transporter. May be a major component for providing zinc to insulin maturation and/or storage processes in insulin-secreting pancreatic beta-cells.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.8 kDa

References & Citations

"In vivo expression and functional characterization of the zinc transporter ZnT8 in glucose-induced insulin secretion." Chimienti F., Devergnas S., Pattou F., Schuit F., Garcia-Cuenca R., Vandewalle B., Kerr-Conte J., Van Lommel L., Grunwald D., Favier A., Seve M. J. Cell Sci. 119:4199-4206 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human F8A2 qPCR Primer Pair
QH79401S 200 Tests

Human F8A2 qPCR Primer Pair

Ask
View Details
MEOX2 Antibody
MBS9505086-01 0.05 mL

MEOX2 Antibody

Ask
View Details
MEOX2 Antibody
MBS9505086-02 0.1 mL

MEOX2 Antibody

Ask
View Details
MEOX2 Antibody
MBS9505086-03 5x 0.1 mL

MEOX2 Antibody

Ask
View Details
ATG4C (AUT Like 1 Cysteine Endopeptidase (S. Cerevisiae), APG4 Autophagy 4 Homolog C, Cysteine Protease ATG4C, APG4-C, Autophagy-Related Cysteine Endopeptidase 3, EC:3.4.22., ATG 4C, AUT Like 1, Cysteine Endopeptidase, EC 3.4.22, APG4C, Autophagin-3, OTTHUMP00000010715, AUTL3, APG4 Autophagy 4 Homolog C (S. Cerevisiae), Autophagy Related Cysteine Endopeptidase 3, ATG4C, Autophagin 3, ATG4 Autophagy Related 4 Homolog C, AUT Like 3 Cysteine Endopeptidase, AUTL1, ATG4C HUMAN, AUT (S. Cerevisiae) Like 1, Cysteine Endopeptidase, Autophagy-Related Protein 4 Homolog C, Autophagy Related Protein 4 Homolog C, ATG4 Autophagy Related 4 Homolog C (S. Cerevisiae), Autophagy Related 4C Cysteine Peptidase, Atg4c, APG4 C, FLJ14867, AUT-Like 3 Cysteine Endopeptidase) discontinued
384990 100 µg

ATG4C (AUT Like 1 Cysteine Endopeptidase (S. Cerevisiae), APG4 Autophagy 4 Homolog C, Cysteine Protease ATG4C, APG4-C, Autophagy-Related Cysteine Endopeptidase 3, EC:3.4.22., ATG 4C, AUT Like 1, Cysteine Endopeptidase, EC 3.4.22, APG4C, Autophagin-3, OTTHUMP00000010715, AUTL3, APG4 Autophagy 4 Homolog C (S. Cerevisiae), Autophagy Related Cysteine Endopeptidase 3, ATG4C, Autophagin 3, ATG4 Autophagy Related 4 Homolog C, AUT Like 3 Cysteine Endopeptidase, AUTL1, ATG4C HUMAN, AUT (S. Cerevisiae) Like 1, Cysteine Endopeptidase, Autophagy-Related Protein 4 Homolog C, Autophagy Related Protein 4 Homolog C, ATG4 Autophagy Related 4 Homolog C (S. Cerevisiae), Autophagy Related 4C Cysteine Peptidase, Atg4c, APG4 C, FLJ14867, AUT-Like 3 Cysteine Endopeptidase) discontinued

Ask
View Details
Varlilumab ELISA Kit
DB796018 96 Tests

Varlilumab ELISA Kit

Ask
View Details