Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calcitonin/CALCA, Human (His, solution)

Calcitonin Protein, Human (His, solution), is a recombinant human Calcitonin expressed in E. coli with a His tag at the C-terminus. Calcitonin has an effect on decreasing osteoclast activity and has the potential for hypercalcemia research[1].

Product Specifications

Product Name Alternative

Calcitonin/CALCA Protein, Human (His, solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calcitonin-protein-human-his.html

Purity

98.0

Smiles

YVQMKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNANHHHHHH

Molecular Formula

796 (Gene_ID) P01258-1 (Y58-N141) (Accession)

Molecular Weight

Approximately 16.0 kDa

References & Citations

[1]Arnold J Felsenfeld, et al. Calcitonin, the forgotten hormone: does it deserve to be forgotten? Clin Kidney J. 2015 Apr;8 (2) :180-7.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Optitrol Green
SR11043 2x 5 mL

Optitrol Green

Sign In for Pricing
View Details
Frozen Tissue Sections, Small intestine
CS626369 5x 5 µm

Frozen Tissue Sections, Small intestine

Sign In for Pricing
View Details
PADI4 Antibody (Biotin)
KB-12117-01 50 μL

PADI4 Antibody (Biotin)

Sign In for Pricing
View Details
PADI4 Antibody (Biotin)
KB-12117-02 100 µL

PADI4 Antibody (Biotin)

Sign In for Pricing
View Details
PADI4 Antibody (Biotin)
KB-12117-03 1 mL

PADI4 Antibody (Biotin)

Sign In for Pricing
View Details
Liver Carboxylesterase 1 (CES1) (NM_001025194) Human Over-expression Lysate
LC422599 20 µg

Liver Carboxylesterase 1 (CES1) (NM_001025194) Human Over-expression Lysate

Sign In for Pricing
View Details