Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus 133/2005 Spike glycoprotein (S), partial

Product Specifications

Product Name Alternative

S glycoprotein

Abbreviation

Recombinant Bat coronavirus 133/2005 S protein, partial

Gene Name

S

UniProt

Q0Q4F2

Expression Region

372-611aa

Organism

Bat coronavirus 133/2005 (BtCoV) (BtCoV/133/2005)

Target Sequence

EASATGTFIEQPNVTECDFSPMLTGVAPQVYNFKRLVFSNCNYNLTKLLSLFAVDEFSCNGISPDAIARGCYSTLTVDYFAYPLSMKSYIRPGSAGNIPLYNYKQSFANPTCRVMASVPDNVTITKPGAYGYISKCSRLTGVNQDIETPLYINPGEYSICRDFAPLGFSEDGQVFKRTLTQFEGGGLLIGVGTRVPMTANLEMGFVISVQYGTGTDSVCPMLDLGDSLTITNRLGKCVDY

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Others

Relevance

Attaches the virion to the cell membrane by interacting with host receptor, initiating the infection.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human C8orf33 shRNA (UAS) - Lentiviral human C8orf33 shRNA (UAS, GFP) (25)
GTR15086780 1 Vial

Lentiviral human C8orf33 shRNA (UAS) - Lentiviral human C8orf33 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
AdmiRa-Off-hsa-miR-8057 Virus
mh7541 1.0 mL

AdmiRa-Off-hsa-miR-8057 Virus

Sign In for Pricing
View Details
Magic™ Human NTRK1 & LMNA (V573M) BaF3 Cell Line
S01YF-1222-KX818 1 Vial

Magic™ Human NTRK1 & LMNA (V573M) BaF3 Cell Line

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog (Y18D10A.9)
MBS1484269-01 0.02 mg (E-Coli)

Recombinant Caenorhabditis elegans Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog (Y18D10A.9)

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog (Y18D10A.9)
MBS1484269-02 0.02 mg (Yeast)

Recombinant Caenorhabditis elegans Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog (Y18D10A.9)

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog (Y18D10A.9)
MBS1484269-03 0.1 mg (E-Coli)

Recombinant Caenorhabditis elegans Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog (Y18D10A.9)

Sign In for Pricing
View Details