Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leukocyte surface antigen CD47 (CD47), partial (Active)

Product Specifications

Product Name Alternative

Leukocyte Surface Antigen CD47; Antigenic Surface Determinant Protein OA3; Integrin-Associated Protein; IAP; Protein MER6; CD47; MER6

Abbreviation

Recombinant Human CD47 protein, partial (Active)

Gene Name

CD47

UniProt

Q08722

Expression Region

19-139aa

Organism

Homo sapiens (Human)

Target Sequence

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Tag

C-terminal 6xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

CD47 (Integrin-Associated Protein, IAP) is a 40 ‑ 60 kDa variably glycosylated atypical member of the immunoglobulin superfamily. The ubiquitously expressed CD47 binds to SIRP family members on macrophages, neutrophils, and T cells. CD47 is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The protein is also a receptor for the C-terminal cell-binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This protein has broad tissue distribution, and is reduced in expression on Rh erythrocytes.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Loaded Anti-Human CD47 mAb-Fc on Protein A Biosensor, can bind Human CD47-His with an affinity constant of 0.22 nM as determined in BLI assay.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 10 mM Tris-Citrate, 150 mM NaCl, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus (By similarity) . Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection.

Molecular Weight

14.76 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12923652/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Clcn2 Mouse siRNA Oligo Duplex (Locus ID 12724)
SR421120 1 Kit

Clcn2 Mouse siRNA Oligo Duplex (Locus ID 12724)

Ask
View Details
Rabbit Polyclonal TOR1AIP2 Antibody [Alexa Fluor 405]
NBP2-98140AF405 0.1 mL

Rabbit Polyclonal TOR1AIP2 Antibody [Alexa Fluor 405]

Ask
View Details
Sall4 (NM_201395) Mouse Tagged ORF Clone Lentiviral Particle
MR226826L3V 200 µL

Sall4 (NM_201395) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
CANT1 Polyclonal Antibody, Biotin Conjugated
A55893-100 100 µL

CANT1 Polyclonal Antibody, Biotin Conjugated

Ask
View Details
Rabbit Polyclonal VSIG3/IGSF11 Antibody [Alexa Fluor 750]
NBP3-00068AF750 0.1 mL

Rabbit Polyclonal VSIG3/IGSF11 Antibody [Alexa Fluor 750]

Ask
View Details
Nub1 (NM_001013925) Rat Tagged ORF Clone Lentiviral Particle
RR206815L4V 200 µL

Nub1 (NM_001013925) Rat Tagged ORF Clone Lentiviral Particle

Ask
View Details