Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leukocyte surface antigen CD47 (CD47), partial (Active)

Product Specifications

Product Name Alternative

Leukocyte Surface Antigen CD47; Antigenic Surface Determinant Protein OA3; Integrin-Associated Protein; IAP; Protein MER6; CD47; MER6

Abbreviation

Recombinant Human CD47 protein, partial (Active)

Gene Name

CD47

UniProt

Q08722

Expression Region

19-139aa

Organism

Homo sapiens (Human)

Target Sequence

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Tag

C-terminal 6xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

CD47 (Integrin-Associated Protein, IAP) is a 40 ‑ 60 kDa variably glycosylated atypical member of the immunoglobulin superfamily. The ubiquitously expressed CD47 binds to SIRP family members on macrophages, neutrophils, and T cells. CD47 is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The protein is also a receptor for the C-terminal cell-binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This protein has broad tissue distribution, and is reduced in expression on Rh erythrocytes.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Loaded Anti-Human CD47 mAb-Fc on Protein A Biosensor, can bind Human CD47-His with an affinity constant of 0.22 nM as determined in BLI assay.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 10 mM Tris-Citrate, 150 mM NaCl, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus (By similarity) . Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection.

Molecular Weight

14.76 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EFGM rabbit pAb
ES9642-01 50 µL

EFGM rabbit pAb

Sign In for Pricing
View Details
EFGM rabbit pAb
ES9642-02 100 µL

EFGM rabbit pAb

Sign In for Pricing
View Details
Rabbit Anti AMHR2 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot)
IRBAMLAMHR2AP191120UL 1 Each

Rabbit Anti AMHR2 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot)

Sign In for Pricing
View Details
Acetylcholinesterase Protein, Mouse, Recombinant (His Tag)
E45M53076M2-20 20 µg

Acetylcholinesterase Protein, Mouse, Recombinant (His Tag)

Sign In for Pricing
View Details
Recombinant Citrobacter koseri UPF0056 inner membrane protein marC (marC)
MBS1115905 Inquire

Recombinant Citrobacter koseri UPF0056 inner membrane protein marC (marC)

Sign In for Pricing
View Details
T0901317
S7076-25mg 25 mg

T0901317

Sign In for Pricing
View Details