Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRO-alpha/CXCL1, Mouse (HEK293, His)

CXCL1 (Chemokine (C-X-C motif) ligand 1), also known as GRO alpha, NAP-3 or MGSA, belongs to the sub-family of CXC chemokine. CXCL1 is involved in the development of many inflammatory diseases, including the induction of angiogenesis and recruitment of neutrophils. CXCL1 is produced by many cell types, and activates CXCR2 and, at high levels, CXCR1[1]. GRO-alpha/CXCL1 Protein, Mouse (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 77 amino acids (A20-N96) .

Product Specifications

Product Name Alternative

GRO-alpha/CXCL1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gro-alpha-cxcl1-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

RLATGAPIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK

Molecular Formula

14825 (Gene_ID) P12850 (R20-K96) (Accession)

Molecular Weight

Approximately 10-13 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Jan Korbecki, et al. CXCL1: Gene, Promoter, Regulation of Expression, mRNA Stability, Regulation of Activity in the Intercellular Space. Int J Mol Sci. 2022 Jan 12;23 (2) :792.|[2]Sheng-Mou Hou, et al. CXCL1 contributes to IL-6 expression in osteoarthritis and rheumatoid arthritis synovial fibroblasts by CXCR2, c-Raf, MAPK, and AP-1 pathway. Arthritis Res Ther. 2020 Oct 21;22 (1) :251.|[3]Huey-ming Lo, et al. TNF-α induces CXCL1 chemokine expression and release in human vascular endothelial cells in vitro via two distinct signaling pathways. Acta Pharmacol Sin. 2014 Mar;35 (3) :339-50.|[4]M Kouwenberg, et al. Reduced CXCL1 production by endogenous IL-37 expressing dendritic cells does not affect T cell activation. PLoS One. 2021 May 24;16 (5) :e0251809.|[5]Jung-Eun Jang, et al. CXCL1 and its receptor, CXCR2, mediate murine sickle cell vaso-occlusion during hemolytic transfusion reactions. J Clin Invest. 2011 Apr;121 (4) :1397-401.|[6]Yuan Sun, et al. Opioids enhance CXCL1 expression and function after incision in mice. J Pain. 2014 Aug;15 (8) :856-66.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Lymphocyte antigen 86, LY86 ELISA Kit
MBS9336511-01 48 Well

Mouse Lymphocyte antigen 86, LY86 ELISA Kit

Sign In for Pricing
View Details
Mouse Lymphocyte antigen 86, LY86 ELISA Kit
MBS9336511-02 96 Well

Mouse Lymphocyte antigen 86, LY86 ELISA Kit

Sign In for Pricing
View Details
Mouse Lymphocyte antigen 86, LY86 ELISA Kit
MBS9336511-03 5x 96 Well

Mouse Lymphocyte antigen 86, LY86 ELISA Kit

Sign In for Pricing
View Details
Mouse Lymphocyte antigen 86, LY86 ELISA Kit
MBS9336511-04 10x 96 Well

Mouse Lymphocyte antigen 86, LY86 ELISA Kit

Sign In for Pricing
View Details
CD33 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-1514R-BF350-TR 20 µL

CD33 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
AMHR2 Protein Vector (Rat) (pPB-C-His)
PV253410 500 ng

AMHR2 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details