Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bcl-2-like 2, Human (His)

Bcl-2-like protein 2 is a key regulator that promotes cell survival and prevents dexamethasone-induced apoptosis, which is critical for postmitotic Sertoli cells. It inhibits BAX, emphasizing its role in survival mechanisms. Bcl-2-like protein 2 Protein, Human (His) is the recombinant human-derived Bcl-2-like protein 2 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Bcl-2-like protein 2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bcl-2-like-protein-2-protein--human-his.html

Purity

98.0

Smiles

ATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRT

Molecular Formula

599 (Gene_ID) AAI13523.1 (A2-T172) (Accession)

Molecular Weight

Approximately 18.0 kDa

References & Citations

[1]Liu HN, et al. MiR-93 Inhibits Trophoblast Cell Proliferation and Promotes Cell Apoptosis by Targeting BCL2L2 in Recurrent Spontaneous Abortion. Reprod Sci. 2020;27 (1) :152-162.|[2]Hartman ML, et al. BCL-w: apoptotic and non-apoptotic role in health and disease. Cell Death Dis. 2020;11 (4) :260. Published 2020 Apr 21.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse E3 ubiquitin-protein ligase ZNRF2, ZNRF2 ELISA Kit
MBS9323187-01 48 Well

Mouse E3 ubiquitin-protein ligase ZNRF2, ZNRF2 ELISA Kit

Ask
View Details
Mouse E3 ubiquitin-protein ligase ZNRF2, ZNRF2 ELISA Kit
MBS9323187-02 96 Well

Mouse E3 ubiquitin-protein ligase ZNRF2, ZNRF2 ELISA Kit

Ask
View Details
Mouse E3 ubiquitin-protein ligase ZNRF2, ZNRF2 ELISA Kit
MBS9323187-03 5x 96 Well

Mouse E3 ubiquitin-protein ligase ZNRF2, ZNRF2 ELISA Kit

Ask
View Details
Mouse E3 ubiquitin-protein ligase ZNRF2, ZNRF2 ELISA Kit
MBS9323187-04 10x 96 Well

Mouse E3 ubiquitin-protein ligase ZNRF2, ZNRF2 ELISA Kit

Ask
View Details
Kv7.4/KCNQ4 K+ channel Antibody
E55A14727 100 µg

Kv7.4/KCNQ4 K+ channel Antibody

Ask
View Details
Rabbit Polyclonal NOXRED1 Antibody [Alexa Fluor 488]
NBP2-99260AF488 0.1 mL

Rabbit Polyclonal NOXRED1 Antibody [Alexa Fluor 488]

Ask
View Details