Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bcl-2-like 2, Human (His)

Bcl-2-like protein 2 is a key regulator that promotes cell survival and prevents dexamethasone-induced apoptosis, which is critical for postmitotic Sertoli cells. It inhibits BAX, emphasizing its role in survival mechanisms. Bcl-2-like protein 2 Protein, Human (His) is the recombinant human-derived Bcl-2-like protein 2 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Bcl-2-like protein 2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bcl-2-like-protein-2-protein--human-his.html

Purity

98.0

Smiles

ATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRT

Molecular Formula

599 (Gene_ID) AAI13523.1 (A2-T172) (Accession)

Molecular Weight

Approximately 18.0 kDa

References & Citations

[1]Liu HN, et al. MiR-93 Inhibits Trophoblast Cell Proliferation and Promotes Cell Apoptosis by Targeting BCL2L2 in Recurrent Spontaneous Abortion. Reprod Sci. 2020;27 (1) :152-162.|[2]Hartman ML, et al. BCL-w: apoptotic and non-apoptotic role in health and disease. Cell Death Dis. 2020;11 (4) :260. Published 2020 Apr 21.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal MTBP Antibody (2C1E11) [Alexa Fluor 594]
NBP2-50517AF594 0.1 mL

Mouse Monoclonal MTBP Antibody (2C1E11) [Alexa Fluor 594]

Ask
View Details
Lentiviral mouse Kcnh4 shRNA (UAS) - Lentiviral mouse Kcnh4 shRNA (UAS, RFP) (25)
GTR15251651 1 Vial

Lentiviral mouse Kcnh4 shRNA (UAS) - Lentiviral mouse Kcnh4 shRNA (UAS, RFP) (25)

Ask
View Details
LZTS3 antibody
FNab06804 100 µg

LZTS3 antibody

Ask
View Details
P16 INK4a (Cyclin-Dependent Kinase Inhibitor 2A, Cyclin-Dependent Kinase 4 Inhibitor A, CDK4I, Multiple Tumor Suppressor 1, MTS-1, p16-INK4a, p16-INK4, p16INK4A, CDKN2A, CDKN2, MTS1) discontinued
224733-01 50 µL

P16 INK4a (Cyclin-Dependent Kinase Inhibitor 2A, Cyclin-Dependent Kinase 4 Inhibitor A, CDK4I, Multiple Tumor Suppressor 1, MTS-1, p16-INK4a, p16-INK4, p16INK4A, CDKN2A, CDKN2, MTS1) discontinued

Ask
View Details
P16 INK4a (Cyclin-Dependent Kinase Inhibitor 2A, Cyclin-Dependent Kinase 4 Inhibitor A, CDK4I, Multiple Tumor Suppressor 1, MTS-1, p16-INK4a, p16-INK4, p16INK4A, CDKN2A, CDKN2, MTS1) discontinued
224733-02 100 µL

P16 INK4a (Cyclin-Dependent Kinase Inhibitor 2A, Cyclin-Dependent Kinase 4 Inhibitor A, CDK4I, Multiple Tumor Suppressor 1, MTS-1, p16-INK4a, p16-INK4, p16INK4A, CDKN2A, CDKN2, MTS1) discontinued

Ask
View Details