Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAG-3, Human (HEK293, His)

LAG-3 (lymphocyte activating gene 3) protein is an inhibitory receptor on antigen-activated T cells and is critical for immune regulation. LAG-3 binds to FGL1 and transmits inhibitory signals that negatively affect CD8 (+) and CD4 (+) T cell proliferation, activation, and effector functions. LAG-3 Protein, Human (HEK293, His) is the recombinant human-derived LAG-3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LAG-3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lag-3-protein-human-hek-293-his.html

Purity

98.0

Smiles

LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHL

Molecular Formula

3902 (Gene_ID) P18627-1 (L23-L450) (Accession)

Molecular Weight

60-80 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cd160 (NM_001163497) Mouse Tagged ORF Clone Lentiviral Particle
MR217975L3V 200 µL

Cd160 (NM_001163497) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Syringalide A 3'-rhamnoside
048741 5 mg

Syringalide A 3'-rhamnoside

Sign In for Pricing
View Details
Recombinant Shigella Flexneri yrbL Protein (aa 1-210)
VAng-Lsx08503-500gEcoli 500 µg (E. coli)

Recombinant Shigella Flexneri yrbL Protein (aa 1-210)

Sign In for Pricing
View Details
Rat Ras-Related Protein Rab-3C (RAB3C) ELISA Kit
MBS9398789-01 48 Well

Rat Ras-Related Protein Rab-3C (RAB3C) ELISA Kit

Sign In for Pricing
View Details
Rat Ras-Related Protein Rab-3C (RAB3C) ELISA Kit
MBS9398789-02 96 Well

Rat Ras-Related Protein Rab-3C (RAB3C) ELISA Kit

Sign In for Pricing
View Details
Rat Ras-Related Protein Rab-3C (RAB3C) ELISA Kit
MBS9398789-03 5x 96 Well

Rat Ras-Related Protein Rab-3C (RAB3C) ELISA Kit

Sign In for Pricing
View Details