Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAG-3, Human (HEK293, His)

LAG-3 (lymphocyte activating gene 3) protein is an inhibitory receptor on antigen-activated T cells and is critical for immune regulation. LAG-3 binds to FGL1 and transmits inhibitory signals that negatively affect CD8 (+) and CD4 (+) T cell proliferation, activation, and effector functions. LAG-3 Protein, Human (HEK293, His) is the recombinant human-derived LAG-3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LAG-3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lag-3-protein-human-hek-293-his.html

Purity

98.0

Smiles

LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHL

Molecular Formula

3902 (Gene_ID) P18627-1 (L23-L450) (Accession)

Molecular Weight

60-80 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCMV6-AN-6xHis-HA-RNF148 (human) HRD1
BZ25623 1 Vial

PCMV6-AN-6xHis-HA-RNF148 (human) HRD1

Sign In for Pricing
View Details
SNAPC3 (NM_001039697) Human Over-expression Lysate
LY421891 100 µg

SNAPC3 (NM_001039697) Human Over-expression Lysate

Sign In for Pricing
View Details
TAF II p28 (A-4) AC
sc-393100 AC 500 µg/mL - 25% ag

TAF II p28 (A-4) AC

Sign In for Pricing
View Details
Recombinant Bacillus anthracis Putative phosphotransferase BAMEG_4558 (BAMEG_4558)
MBS1174958-01 0.02 mg (E-Coli)

Recombinant Bacillus anthracis Putative phosphotransferase BAMEG_4558 (BAMEG_4558)

Sign In for Pricing
View Details
Recombinant Bacillus anthracis Putative phosphotransferase BAMEG_4558 (BAMEG_4558)
MBS1174958-02 0.02 mg (Yeast)

Recombinant Bacillus anthracis Putative phosphotransferase BAMEG_4558 (BAMEG_4558)

Sign In for Pricing
View Details
Recombinant Bacillus anthracis Putative phosphotransferase BAMEG_4558 (BAMEG_4558)
MBS1174958-03 0.1 mg (E-Coli)

Recombinant Bacillus anthracis Putative phosphotransferase BAMEG_4558 (BAMEG_4558)

Sign In for Pricing
View Details