Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Human (HEK293)

TRAIL R2/TNFRSF10B Protein, Human (HEK293) is a cell surface receptor of the TNF-receptor superfamily that binds TRAIL and mediates apoptosis.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-r2-tnfrsf10b-protein-human-hek293.html

Purity

96.06

Smiles

ALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE

Molecular Formula

8795 (Gene_ID) O14763 (A54-E182) (Accession)

Molecular Weight

Approximately 16.22 kDa

References & Citations

[1]Tahir RA, et al. Tumor necrosis factor receptor superfamily 10B (TNFRSF10B) : an insight from structure modeling to virtual screening for designing drug against head and neck cancer. Theor Biol Med Model. 2013 Jun 1;10:38.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNPDA1 Antibody
A23523-100UL 100 µL

GNPDA1 Antibody

Sign In for Pricing
View Details
Caspase 1 (pS376) Antibody
abx148922 100 µg

Caspase 1 (pS376) Antibody

Sign In for Pricing
View Details
ST8SIA1 Protein Vector (Human) (pPM-C-His)
PV058392 500 ng

ST8SIA1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
mmu-miR-431-3p Primers
MPM01302 150 µL / 10 µM

mmu-miR-431-3p Primers

Sign In for Pricing
View Details
1-Methyl-3-propylimidazolium bis (trifluoromethylsulfonyl) imide
IL-0024-UP-0500 500 g

1-Methyl-3-propylimidazolium bis (trifluoromethylsulfonyl) imide

Sign In for Pricing
View Details
Metazachlor Oxalic Acid-d6
454444-01 1 mg

Metazachlor Oxalic Acid-d6

Sign In for Pricing
View Details