Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Human (HEK293)

TRAIL R2/TNFRSF10B Protein, Human (HEK293) is a cell surface receptor of the TNF-receptor superfamily that binds TRAIL and mediates apoptosis.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-r2-tnfrsf10b-protein-human-hek293.html

Purity

96.06

Smiles

ALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE

Molecular Formula

8795 (Gene_ID) O14763 (A54-E182) (Accession)

Molecular Weight

Approximately 16.22 kDa

References & Citations

[1]Tahir RA, et al. Tumor necrosis factor receptor superfamily 10B (TNFRSF10B) : an insight from structure modeling to virtual screening for designing drug against head and neck cancer. Theor Biol Med Model. 2013 Jun 1;10:38.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL23AP26 3'UTR Luciferase Stable Cell Line
TU021089 1.0 mL

RPL23AP26 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Anti-AKT3 Antibody
CPA9227-01 30 µL

Anti-AKT3 Antibody

Sign In for Pricing
View Details
Anti-AKT3 Antibody
CPA9227-02 50 μL

Anti-AKT3 Antibody

Sign In for Pricing
View Details
Anti-AKT3 Antibody
CPA9227-03 100 µL

Anti-AKT3 Antibody

Sign In for Pricing
View Details
Anti-AKT3 Antibody
CPA9227-04 200 µL

Anti-AKT3 Antibody

Sign In for Pricing
View Details
Eukaryotic Growth Hormone (GH), Recombinant, Bovine, His-Tag
057929-01 10 µg

Eukaryotic Growth Hormone (GH), Recombinant, Bovine, His-Tag

Sign In for Pricing
View Details